TYRP1 Antibody


Western Blot: TYRP1 Antibody [NBP1-69542] - Sample Tissue: Human 786-0 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-69542] - Human Skin.
Western Blot: TYRP1 Antibody [NBP1-69542] - This Anti-TYRP1 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.
Western Blot: TYRP1 Antibody [NBP1-69542] - Sample Tissue: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TYRP1 Antibody Summary

Synthetic peptides corresponding to TYRP1(tyrosinase-related protein 1) The peptide sequence was selected from the middle region of TYRP1. Peptide sequence NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TYRP1 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-69542.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TYRP1 Antibody

  • CAS25,6-dihydroxyindole-2-carboxylic acid oxidase
  • Catalase B
  • CATB
  • EC 1.14.18
  • EC 1.14.18.-
  • EC
  • Glycoprotein 75
  • GP75DHICA oxidase
  • Melanoma antigen gp75
  • TRP-1
  • tyrosinase-related protein 1TRP1


TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Dr
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TYRP1 Antibody (NBP1-69542)(1)

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for TYRP1 Antibody (NBP1-69542) (0)

There are no reviews for TYRP1 Antibody (NBP1-69542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TYRP1 Antibody (NBP1-69542) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TYRP1 Products

Bioinformatics Tool for TYRP1 Antibody (NBP1-69542)

Discover related pathways, diseases and genes to TYRP1 Antibody (NBP1-69542). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYRP1 Antibody (NBP1-69542)

Discover more about diseases related to TYRP1 Antibody (NBP1-69542).

Pathways for TYRP1 Antibody (NBP1-69542)

View related products by pathway.

PTMs for TYRP1 Antibody (NBP1-69542)

Learn more about PTMs related to TYRP1 Antibody (NBP1-69542).

Blogs on TYRP1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TYRP1 Antibody and receive a gift card or discount.


Gene Symbol TYRP1