TRPC6 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TRPC6 Antibody - BSA Free (NBP2-55831) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TRPC6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRPC6 Antibody - BSA Free
Background
The protein encoded by the TRPC6 gene creates receptor-activated cation permeant calcium channels in the cell membrane. Isoform 1 is 931 amino acids in length and is approximately 106 kDa, while isoform 2 is 815 amino acids in lenth at around 93 kDA. Isoform 3 is 876 amino acids long and is just over 100 kDA. Focal segmental glomerulosclerosis 2 (FSGS2) is caused by deficits in the TRPC6 gene. This gene has been linked to diseases such as cystic fibrosis, gigantism, hypertension, kidney disease, glomerulosclerosis, pyloric stenosis, diencephalic neoplasm, premature ovarian failure, and hepatopulmonary syndrome. The TRPC6 gene interacts with MX1, ORAI1, NPHS1, NPHS2, and FYN genes in pathways that monitor sodium as well as calcium channels, EPO signaling pathway, G alpha (q) signaling events, signal transduction, and platelet homeostasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for TRPC6 Antibody (NBP2-55831) (0)
There are no publications for TRPC6 Antibody (NBP2-55831).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRPC6 Antibody (NBP2-55831) (0)
There are no reviews for TRPC6 Antibody (NBP2-55831).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRPC6 Antibody (NBP2-55831) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRPC6 Products
Research Areas for TRPC6 Antibody (NBP2-55831)
Find related products by research area.
|
Blogs on TRPC6