Alpha Actinin 4 Antibody (4D10)

Images

 
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. Antibody concentration 3 ug/ml.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in PC-12.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10 Analysis of ACTN4 expression in Hela S3 NE.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in Raw 264.7.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in MCF-7.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.Lane 1: ACTN4 transfected lysate(104.9 KDa).Lane ...read more
Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
ELISA: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
4D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Alpha Actinin 4 Antibody (4D10) Summary

Immunogen
ACTN4 (NP_004915, 592 a.a. - 701 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Specificity
ACTN4 - actinin, alpha 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACTN4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00000081-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alpha Actinin 4 Antibody (4D10)

  • actinin alpha4 isoform
  • actinin, alpha 4
  • ACTININ-4
  • alpha-actinin-4
  • DKFZp686K23158
  • F-actin cross-linking protein
  • focal segmental glomerulosclerosis 1
  • FSGS
  • FSGS1
  • Non-muscle alpha-actinin 4

Background

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75624
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-32797
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, KO
NBP1-90625
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Alpha Actinin 4 Antibody (H00000081-M01)(3)

Reviews for Alpha Actinin 4 Antibody (H00000081-M01) (0)

There are no reviews for Alpha Actinin 4 Antibody (H00000081-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alpha Actinin 4 Antibody (H00000081-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Alpha Actinin 4 Products

Bioinformatics Tool for Alpha Actinin 4 Antibody (H00000081-M01)

Discover related pathways, diseases and genes to Alpha Actinin 4 Antibody (H00000081-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Actinin 4 Antibody (H00000081-M01)

Discover more about diseases related to Alpha Actinin 4 Antibody (H00000081-M01).
 

Pathways for Alpha Actinin 4 Antibody (H00000081-M01)

View related products by pathway.

PTMs for Alpha Actinin 4 Antibody (H00000081-M01)

Learn more about PTMs related to Alpha Actinin 4 Antibody (H00000081-M01).

Blogs on Alpha Actinin 4

There are no specific blogs for Alpha Actinin 4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha Actinin 4 Antibody (4D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTN4
Entrez
OMIM
Uniprot
Novus 100% Guarantee