TRPC1 Antibody [DyLight 550]

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 550

TRPC1 Antibody [DyLight 550] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).
  
  Sequence:
  LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for TRPC1 Antibody [DyLight 550]

• HTRP-1
• MGC133334
• MGC133335
• transient receptor potential canonical 1
• transient receptor potential cation channel, subfamily C, member 1
• transient receptor potential channel 1
• Transient receptor protein 1
• TRP1
• TRP-1
• TRP1short transient receptor potential channel 1
• TRPC1

Background

The TRP1 (TRPC1) gene encodes for a short transient receptor potential channel 1 protein which creates non-selective channels permeable to calcium and other cations. The long isoform is 793 amino acids long at around 91 kDA while the short isoform is 759 amino acids at approximately 87 kDA. These proteins are believed to be operated by a phosphatidylinositol messenger system. The TRP1 gene interacts with MX1, CAV1, ITPR3, HOMER1, and BMPR2 genes in pathways for CREB transcription, intracellular calcium signaling, developmental biology and pancreatic secretion. The TRP1 gene has been studied in various diseases such as kidney disease, breast cancer, neuroblastoma, prostatius, retinitis, basal cell carcinoma, muscular dystrophy, gingivitis, hypoxia, cerebritis, neurodegeneration, pyloric stenosis, and bipolar disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPC1