TRP2 Antibody

Images

 
Western Blot: TRP2 Antibody [NBP1-86893] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: TRP2 Antibody [NBP1-86893] - Mouse melanoblasts were incubated for 1h at 37C with anti-Trp2 rabbit 1:200, followed by incubation with Donkey anti-rabbit AF488. ICC/IF image ...read more
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human lymph node.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human testis.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human cerebral cortex using Anti-DCT antibody.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Analysis in human skin and lymph node tissues. Corresponding DCT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skin shows cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86893 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDF
Specificity
Specificity of human TRP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID: 24991188).
Control Peptide
TRP2 Recombinant Protein Antigen (NBP1-86893PEP)
Publications
Read Publication using NBP1-86893.

Reactivity Notes

Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRP2 Antibody

  • dopachrome delta-isomerase
  • dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
  • DT
  • EC 5.3.3.12
  • L-dopachrome tautomerase
  • TRP2
  • TRP-2
  • Tyrosinase-related protein 2
  • TYRP2
  • TYRP2L-dopachrome Delta-isomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
259-HE
Species: Hu
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-93337
Species: Hu, Mu
Applications: WB, IP
NBP1-86893
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRP2 Antibody (NBP1-86893)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for TRP2 Antibody (NBP1-86893) (0)

There are no reviews for TRP2 Antibody (NBP1-86893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRP2 Antibody (NBP1-86893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRP2 Products

Bioinformatics Tool for TRP2 Antibody (NBP1-86893)

Discover related pathways, diseases and genes to TRP2 Antibody (NBP1-86893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRP2 Antibody (NBP1-86893)

Discover more about diseases related to TRP2 Antibody (NBP1-86893).
 

Pathways for TRP2 Antibody (NBP1-86893)

View related products by pathway.

PTMs for TRP2 Antibody (NBP1-86893)

Learn more about PTMs related to TRP2 Antibody (NBP1-86893).
 

Research Areas for TRP2 Antibody (NBP1-86893)

Find related products by research area.

Blogs on TRP2

There are no specific blogs for TRP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCT