TRIP1 Antibody

Images

 
Western Blot: TRIP1 Antibody [NBP1-84874] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: TRIP1 Antibody [NBP1-84874] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3I
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIP1 Protein (NBP1-84874PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIP1 Antibody

  • eIF-3-beta
  • eIF3-beta
  • eIF3i
  • eIF3-p36
  • EIF3S2TGF-beta receptor-interacting protein 1
  • Eukaryotic translation initiation factor 3 subunit 2
  • eukaryotic translation initiation factor 3 subunit I
  • eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD)
  • eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa
  • eukaryotic translation initiation factor 3, subunit I
  • predicted protein of HQ2242
  • TGFbeta receptor-interacting protein 1
  • TRIP-1
  • TRIP-1eIF3 p36
  • TRIP1PRO2242

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-345
Species: Hu
Applications: WB, ChIP, IP
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02316
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-24672
Species: Hu
Applications: WB
NBP2-03822
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24524
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr

Publications for TRIP1 Antibody (NBP1-84874) (0)

There are no publications for TRIP1 Antibody (NBP1-84874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIP1 Antibody (NBP1-84874) (0)

There are no reviews for TRIP1 Antibody (NBP1-84874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIP1 Antibody (NBP1-84874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIP1 Products

Bioinformatics Tool for TRIP1 Antibody (NBP1-84874)

Discover related pathways, diseases and genes to TRIP1 Antibody (NBP1-84874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIP1 Antibody (NBP1-84874)

Discover more about diseases related to TRIP1 Antibody (NBP1-84874).
 

Pathways for TRIP1 Antibody (NBP1-84874)

View related products by pathway.

PTMs for TRIP1 Antibody (NBP1-84874)

Learn more about PTMs related to TRIP1 Antibody (NBP1-84874).
 

Research Areas for TRIP1 Antibody (NBP1-84874)

Find related products by research area.

Blogs on TRIP1

There are no specific blogs for TRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3I