TRIP1 Antibody - BSA Free

Western Blot: TRIP1 Antibody [NBP1-84874] - Analysis using Anti-EIF3I antibody NBP1-84874 (A) shows similar pattern to independent antibody NBP1-84873 (B).

Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human cerebral cortex, endometrium, liver and urinary bladder using Anti-UPK2 antibody (A) NBP1-84874 shows similar protein distribution across tissues to independent antibody NBP1-84873 (B).

Western Blot: TRIP1 Antibody [NBP1-84874] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human cerebral cortex strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TRIP1 Antibody [NBP1-84874] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3I
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRIP1 Protein (NBP1-84874PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIP1 Antibody - BSA Free

• eIF-3-beta
• eIF3-beta
• eIF3i
• eIF3-p36
• EIF3S2TGF-beta receptor-interacting protein 1
• Eukaryotic translation initiation factor 3 subunit 2
• eukaryotic translation initiation factor 3 subunit I
• eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD)
• eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa
• eukaryotic translation initiation factor 3, subunit I
• predicted protein of HQ2242
• TGFbeta receptor-interacting protein 1
• TRIP-1
• TRIP-1eIF3 p36
• TRIP1PRO2242

Background

TRIP1 is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, e

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3I