GCHFR Antibody - BSA Free

Western Blot: GCHFR Antibody [NBP1-91931] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: GCHFR Antibody [NBP1-91931] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: GCHFR Antibody [NBP1-91931] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Western Blot: GCHFR Antibody [NBP1-91931] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Staining of human kidney shows moderate cytoplasmic positivity in cells in proximal tubules.

Staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.

Analysis in human cell line SCLC-21H.

Analysis in human liver and testis tissues using NBP1-91931 antibody. Corresponding GCHFR RNA-seq data are presented for the same tissues.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCHFR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCHFR Antibody - BSA Free (NBP1-91931) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCHFR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GCHFR Protein (NBP1-91931PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GCHFR Antibody - BSA Free

• GCHFR
• GFRP
• GFRPP35
• GTP cyclohydrolase I feedback regulator
• GTP cyclohydrolase I feedback regulatory proteinGTP cyclohydrolase 1 feedback regulatory protein
• HsT16933
• MGC138467
• MGC138469
• p35

Background

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCHFR