TRAIP Antibody

Images

 
Western Blot: TRAIP Antibody [NBP1-87125] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: TRAIP Antibody [NBP1-87125] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: TRAIP Antibody [NBP1-87125] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAIP Protein (NBP1-87125PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAIP Antibody

  • RNF206TRIPRING finger protein 206
  • TRAF interacting protein
  • TRAF-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-26506
Species: Hu, Mu, Rt
NBP1-92507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24672
Species: Hu
Applications: WB
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
930-ADB
Species: Hu
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB100-56178
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for TRAIP Antibody (NBP1-87125) (0)

There are no publications for TRAIP Antibody (NBP1-87125).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAIP Antibody (NBP1-87125) (0)

There are no reviews for TRAIP Antibody (NBP1-87125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAIP Antibody (NBP1-87125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAIP Products

Bioinformatics Tool for TRAIP Antibody (NBP1-87125)

Discover related pathways, diseases and genes to TRAIP Antibody (NBP1-87125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAIP Antibody (NBP1-87125)

Discover more about diseases related to TRAIP Antibody (NBP1-87125).
 

Pathways for TRAIP Antibody (NBP1-87125)

View related products by pathway.

PTMs for TRAIP Antibody (NBP1-87125)

Learn more about PTMs related to TRAIP Antibody (NBP1-87125).
 

Research Areas for TRAIP Antibody (NBP1-87125)

Find related products by research area.

Blogs on TRAIP

There are no specific blogs for TRAIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAIP