YARS Antibody

Images

 
Genetic Strategies: Western Blot: YARS Antibody [NBP1-86889] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-YARS antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: YARS Antibody [NBP1-86889] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining in human cerebral cortex and skeletal muscle tissues using NBP1-86889 antibody. Corresponding YARS RNA-seq data are presented for the same tissues.
Western Blot: YARS Antibody [NBP1-86889] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Western Blot: YARS Antibody [NBP1-86889] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining of human cerebral cortex, pancreas, skeletal muscle and testis using Anti-YARS antibody NBP1-86889 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

YARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDAD
Specificity
Specificity of human, mouse, rat YARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YARS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YARS Protein (NBP1-86889PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YARS Antibody

  • CMTDIC
  • EC 6.1.1
  • EC 6.1.1.1
  • Tyrosyl--tRNA ligase
  • tyrosyl-tRNA synthetase
  • tyrosyl-tRNA synthetase, cytoplasmic
  • TYRRS
  • YRStyrRS
  • YTStyrosine tRNA ligase 1, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54653
Species: Hu
Applications: WB
NBP2-32186
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003376-B01P
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
H00006301-M01
Species: Hu, Mu, Ze
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for YARS Antibody (NBP1-86889) (0)

There are no publications for YARS Antibody (NBP1-86889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YARS Antibody (NBP1-86889) (0)

There are no reviews for YARS Antibody (NBP1-86889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for YARS Antibody (NBP1-86889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YARS1