TNIP1 Antibody

Images

 
Western Blot: TNIP1 Antibody [NBP2-32705] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry: TNIP1 Antibody [NBP2-32705] - esophagus
Western Blot: TNIP1 Antibody [NBP2-32705] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry: TNIP1 Antibody [NBP2-32705] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subset of non-germinal center cells.
Immunohistochemistry: TNIP1 Antibody [NBP2-32705] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subset of non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TNIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVT
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Control Peptide
TNIP1 Protein (NBP2-32705PEP)

Alternate Names for TNIP1 Antibody

  • ABIN-1
  • HIV-1 Nef-interacting protein
  • hVAN
  • KIAA0113nip40-1
  • Naf1
  • NAF1TNFAIP3-interacting protein 1
  • Nef-associated factor 1 SNP
  • Nef-associated factor 1
  • Nip40-1
  • TNFAIP3 interacting protein 1
  • VANvirion-associated nuclear-shuttling protein
  • Virion-associated nuclear shuttling protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89305
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56701
Species: Hu, Mu, Rt
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-57138
Species: Hu
Applications: WB
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-32705
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for TNIP1 Antibody (NBP2-32705) (0)

There are no publications for TNIP1 Antibody (NBP2-32705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP1 Antibody (NBP2-32705) (0)

There are no reviews for TNIP1 Antibody (NBP2-32705). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNIP1 Antibody (NBP2-32705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNIP1 Antibody Products

Related Products by Gene

Bioinformatics Tool for TNIP1 Antibody (NBP2-32705)

Discover related pathways, diseases and genes to TNIP1 Antibody (NBP2-32705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNIP1 Antibody (NBP2-32705)

Discover more about diseases related to TNIP1 Antibody (NBP2-32705).
 

Pathways for TNIP1 Antibody (NBP2-32705)

View related products by pathway.

PTMs for TNIP1 Antibody (NBP2-32705)

Learn more about PTMs related to TNIP1 Antibody (NBP2-32705).

Blogs on TNIP1

There are no specific blogs for TNIP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TNIP1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32705 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought