TNIP1 Antibody (NBP2-32705)

Images

 
Western Blot: TNIP1 Antibody [NBP2-32705] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry: TNIP1 Antibody [NBP2-32705] - Staining of human tonsil shows strong cytoplasmic positivity in subset of non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
TNIP1 Protein (NBP2-32705PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNIP1 Antibody

  • ABIN-1
  • HIV-1 Nef-interacting protein
  • hVAN
  • KIAA0113nip40-1
  • Naf1
  • NAF1TNFAIP3-interacting protein 1
  • Nef-associated factor 1 SNP
  • Nef-associated factor 1
  • Nip40-1
  • TNFAIP3 interacting protein 1
  • VANvirion-associated nuclear-shuttling protein
  • Virion-associated nuclear shuttling protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89305
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-57100
Species: Hu
Applications: ICC/IF
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for TNIP1 Antibody (NBP2-32705) (0)

There are no publications for TNIP1 Antibody (NBP2-32705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP1 Antibody (NBP2-32705) (0)

There are no reviews for TNIP1 Antibody (NBP2-32705). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNIP1 Antibody (NBP2-32705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNIP1 Products

Related Products by Gene

Bioinformatics Tool for TNIP1 Antibody (NBP2-32705)

Discover related pathways, diseases and genes to TNIP1 Antibody (NBP2-32705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNIP1 Antibody (NBP2-32705)

Discover more about diseases related to TNIP1 Antibody (NBP2-32705).
 

Pathways for TNIP1 Antibody (NBP2-32705)

View related products by pathway.

PTMs for TNIP1 Antibody (NBP2-32705)

Learn more about PTMs related to TNIP1 Antibody (NBP2-32705).

Blogs on TNIP1

There are no specific blogs for TNIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNIP1