RNPC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RNPC3 Antibody [NBP2-57100] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNPC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
Specificity
Specificity of human RNPC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNPC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNPC3 Recombinant Protein Antigen (NBP2-57100PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNPC3 Antibody

  • FLJ20008
  • FLJ25070
  • KIAA183
  • KIAA1839
  • RBM40U11/U12 snRNP 65 kDa protein
  • RNA recognition protein
  • RNA-binding motif protein 40
  • RNA-binding protein 40
  • RNA-binding region (RNP1, RRM) containing 3
  • RNA-binding region-containing protein 3
  • RNP
  • U11/U12 small nuclear ribonucleoprotein 65 kDa protein
  • U11/U12 snRNP 65K
  • U11/U12-65K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86998
Species: Hu
Applications: IHC, IHC-P, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00005555-P01
Species: Hu
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF

Publications for RNPC3 Antibody (NBP2-57100) (0)

There are no publications for RNPC3 Antibody (NBP2-57100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNPC3 Antibody (NBP2-57100) (0)

There are no reviews for RNPC3 Antibody (NBP2-57100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNPC3 Antibody (NBP2-57100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNPC3 Antibody (NBP2-57100)

Discover related pathways, diseases and genes to RNPC3 Antibody (NBP2-57100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RNPC3 Antibody (NBP2-57100)

View related products by pathway.

Blogs on RNPC3

There are no specific blogs for RNPC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNPC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNPC3