Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 99-215 of Human TLR9 Source: Wheat Germ (in vitro) Amino Acid Sequence: PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Recombinant Protein |
Gene | TLR9 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 38.5 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for TLR9 Partial Recombinant Protein (H00054106-Q01)Find related products by research area.
|
Toll-like receptors in the intestinal epithelial cells By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ... Read full blog post. |
Topics in CD11b: The innate immune response Integrins are transmembrane receptors composed of alpha and beta chains, where beta-integrins are mainly expressed in leukocytes. Leukocytes are white blood cells that act in the immune system to defend our body against foreign pathogens. Integrin... Read full blog post. |
MHC Class I and the Herpes Simplex Virus MHC molecules (also known as major histocompatibility complex molecules) assist in the presentation of antigens to T cells in order to eradicate foreign pathogens. These molecules are highly polymorphic, meaning that they exist in multiple varian... Read full blog post. |
The role of TLR4 in breast cancer Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation. In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy... Read full blog post. |
IRAK4: The "master IRAK" critical for initiating immune responses IRAK4, also known as Interleukin-1 receptor-associated kinase 4, is a serine/threonine-protein kinase that plays a critical role in initiating innate and adaptive immune responses against foreign pathogens. It activates NF-kappaB in both Toll-like rec... Read full blog post. |
TLR9: For Whom the Cell Tolls The Toll-like receptor 9 (TLR9) protein, also known as CD289, belongs to the family of Toll-like receptor (TLR) proteins which play a large role in pathogen recognition and the activation of innate immunity. Scientists using TLR9 antibodies have found... Read full blog post. |
TLR9: Tollgate to Immunity Toll-like receptors (TLRs) play an essential role in the activation of innate immunity, and TLRs are expressed in a large number of immune cells as well as in epithelial cells. TLR9 recognizes synthetic oligodeoxynucleotides (ODN) containing unmethyla... Read full blog post. |
TLR9, Infectious Disease and Cancer Toll-like receptor 9 (TLR9) is a protein encoded by TLR9 gene in humans. It is also known as cluster of differentiation 289 (CD289) and is a member of TLR family. Proteins from TLR family are transmembrane proteins that expressed in both antigen-resen... Read full blog post. |
TLR9 Antibodies in Immunity Research Toll-like receptor 9 (TLR9) is a member of the toll-like receptor family that plays a key role in pathogen recognition and activation of innate immunity. Scientists using TLR9 antibodies have found the protein is highly conserved from Drosophila to hu... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TLR9 |