Recombinant Human TLR9 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TLR9 Protein [H00054106-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related TLR9 Peptides and Proteins

Order Details


    • Catalog Number
      H00054106-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TLR9 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 99-215 of Human TLR9

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TLR9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TLR9 GST (N-Term) Protein

  • CD289 antigen
  • CD289
  • TLR9
  • toll-like receptor 9

Background

TLR9 - toll-like receptor 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP2-24906
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, Simple Western, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
DY417
Species: Mu
Applications: ELISA
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-24917
Species: Hu, Mu, Rb
Applications: CyTOF-ready, DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-24787
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56536
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC,  IHC-P, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB

Publications for TLR9 Partial Recombinant Protein (H00054106-Q01) (0)

There are no publications for TLR9 Partial Recombinant Protein (H00054106-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR9 Partial Recombinant Protein (H00054106-Q01) (0)

There are no reviews for TLR9 Partial Recombinant Protein (H00054106-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLR9 Partial Recombinant Protein (H00054106-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLR9 Products

Research Areas for TLR9 Partial Recombinant Protein (H00054106-Q01)

Find related products by research area.

Blogs on TLR9.

Toll-like receptors in the intestinal epithelial cells
By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ...  Read full blog post.

Topics in CD11b: The innate immune response
Integrins are transmembrane receptors composed of alpha and beta chains, where beta-integrins are mainly expressed in leukocytes. Leukocytes are white blood cells that act in the immune system to defend our body against foreign pathogens.  Integrin...  Read full blog post.

MHC Class I and the Herpes Simplex Virus
MHC molecules (also known as major histocompatibility complex molecules) assist in the presentation of antigens to T cells in order to eradicate foreign pathogens.  These molecules are highly polymorphic, meaning that they exist in multiple varian...  Read full blog post.

The role of TLR4 in breast cancer
Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation.  In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy...  Read full blog post.

IRAK4: The "master IRAK" critical for initiating immune responses
IRAK4, also known as Interleukin-1 receptor-associated kinase 4, is a serine/threonine-protein kinase that plays a critical role in initiating innate and adaptive immune responses against foreign pathogens. It activates NF-kappaB in both Toll-like rec...  Read full blog post.

TLR9: For Whom the Cell Tolls
The Toll-like receptor 9 (TLR9) protein, also known as CD289, belongs to the family of Toll-like receptor (TLR) proteins which play a large role in pathogen recognition and the activation of innate immunity. Scientists using TLR9 antibodies have found...  Read full blog post.

TLR9: Tollgate to Immunity
Toll-like receptors (TLRs) play an essential role in the activation of innate immunity, and TLRs are expressed in a large number of immune cells as well as in epithelial cells. TLR9 recognizes synthetic oligodeoxynucleotides (ODN) containing unmethyla...  Read full blog post.

TLR9, Infectious Disease and Cancer
Toll-like receptor 9 (TLR9) is a protein encoded by TLR9 gene in humans. It is also known as cluster of differentiation 289 (CD289) and is a member of TLR family. Proteins from TLR family are transmembrane proteins that expressed in both antigen-resen...  Read full blog post.

TLR9 Antibodies in Immunity Research
Toll-like receptor 9 (TLR9) is a member of the toll-like receptor family that plays a key role in pathogen recognition and activation of innate immunity. Scientists using TLR9 antibodies have found the protein is highly conserved from Drosophila to hu...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TLR9 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TLR9