Recombinant Human TLR7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TLR7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-126 of Human TLR7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TLR7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TLR7 Protein

  • TLR7
  • toll-like receptor 7

Background

TLR7 - toll-like receptor 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-24917
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC-P, CyTOF-ready, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56536
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00051284-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TLR7 Partial Recombinant Protein (H00051284-Q01) (0)

There are no publications for TLR7 Partial Recombinant Protein (H00051284-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR7 Partial Recombinant Protein (H00051284-Q01) (0)

There are no reviews for TLR7 Partial Recombinant Protein (H00051284-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLR7 Partial Recombinant Protein (H00051284-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLR7 Products

Bioinformatics Tool for TLR7 Partial Recombinant Protein (H00051284-Q01)

Discover related pathways, diseases and genes to TLR7 Partial Recombinant Protein (H00051284-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLR7 Partial Recombinant Protein (H00051284-Q01)

Discover more about diseases related to TLR7 Partial Recombinant Protein (H00051284-Q01).
 

Pathways for TLR7 Partial Recombinant Protein (H00051284-Q01)

View related products by pathway.

PTMs for TLR7 Partial Recombinant Protein (H00051284-Q01)

Learn more about PTMs related to TLR7 Partial Recombinant Protein (H00051284-Q01).
 

Research Areas for TLR7 Partial Recombinant Protein (H00051284-Q01)

Find related products by research area.

Blogs on TLR7.

TLR9: For Whom the Cell Tolls
The Toll-like receptor 9 (TLR9) protein, also known as CD289, belongs to the family of Toll-like receptor (TLR) proteins which play a large role in pathogen recognition and the activation of innate immunity. Scientists using TLR9 antibodies have found...  Read full blog post.

TLR7 and Immune Response Regulation
Toll-like receptor 7 (TLR7) is a protein encoded by the TLR7 gene in humans and is a member of TLR family. TLRs controls host immune response against pathogens (e.g. viruses, bacteria and fungi) through recognition of pathogen-associated molecular pat...  Read full blog post.

TLR9 Antibodies in Immunity Research
Toll-like receptor 9 (TLR9) is a member of the toll-like receptor family that plays a key role in pathogen recognition and activation of innate immunity. Scientists using TLR9 antibodies have found the protein is highly conserved from Drosophila to hu...  Read full blog post.

Customers Who Bought This Also Bought

TLR7 Antibody
NBP2-24906

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TLR7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TLR7
Entrez