TIF1 alpha Antibody (2F2) Summary
Immunogen |
TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW |
Specificity |
TRIM24 - tripartite motif-containing 24 |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TRIM24 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Immunoprecipitation
- Proximity Ligation Assay
- Western Blot
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TIF1 alpha Antibody (2F2)
Background
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
Publications for TIF1 alpha Antibody (H00008805-M01)(4)
Showing Publications 1 -
4 of 4.
Publications using H00008805-M01 |
Applications |
Species |
Dingar D, Kalkat M, Chan PK et al. BioID identifies novel c-MYC interacting partners in cultured cells and xenograft tumors. J Prot. 2014-01-01 [PMID: 26217692] |
|
|
Dingar D, Kalkat M, Chan PK et al. BioID identifies novel c-MYC interacting partners in cultured cells and xenograft tumors. J Proteomics 2015-04-06 [PMID: 25452129] |
|
|
Liu X, Huang Y, Yang D et al. Overexpression of TRIM24 Is Associated with the Onset and Progress of Human Hepatocellular Carcinoma. PLoS One. 2014-01-07 [PMID: 24409330] |
|
|
Kikuchi M, Okumura F, Tsukiyama T et al. TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells. Biochim Biophys Acta. 2009-11-10 [PMID: 19909775] |
|
|
Reviews for TIF1 alpha Antibody (H00008805-M01) (0)
There are no reviews for TIF1 alpha Antibody (H00008805-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TIF1 alpha Antibody (H00008805-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TIF1 alpha Products
Bioinformatics Tool for TIF1 alpha Antibody (H00008805-M01)
Discover related pathways, diseases and genes to TIF1 alpha Antibody (H00008805-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TIF1 alpha Antibody (H00008805-M01)
Discover more about diseases related to TIF1 alpha Antibody (H00008805-M01).
| | Pathways for TIF1 alpha Antibody (H00008805-M01)
View related products by pathway.
|
PTMs for TIF1 alpha Antibody (H00008805-M01)
Learn more about PTMs related to TIF1 alpha Antibody (H00008805-M01).
| | Research Areas for TIF1 alpha Antibody (H00008805-M01)
Find related products by research area.
|
Blogs on TIF1 alpha