TIF1 alpha Antibody (2F2)

Images

 
Western Blot: TIF1 alpha Antibody (2F2) [H00008805-M01] - TRIM24 monoclonal antibody (M01), clone 2F2. Analysis of TRIM24 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. Antibody concentration 6 ug/ml.
Western Blot: TIF1 alpha Antibody (2F2) [H00008805-M01] - TRIM24 monoclonal antibody (M01), clone 2F2 Analysis of TRIM24 expression in IMR-32.
Western Blot: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody (M01), clone 2F2.Lane 1: TRIM24 transfected lysate(116.8 KDa).Lane 2: ...read more
Immunoprecipitation: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM24 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, ICC/IF, IHC, IP
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIF1 alpha Antibody (2F2) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Specificity
TRIM24 - tripartite motif-containing 24
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM24
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Proximity Ligation Assay
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00008805-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 alpha Antibody (2F2)

  • E3 ubiquitin-protein ligase TRIM24
  • EC 6.3.2
  • EC 6.3.2.-
  • hTIF1
  • PTC6
  • RING finger protein 82
  • RNF82
  • RNF82Tif1a
  • TIF1 alpha
  • TIF1
  • TIF1A
  • TIF1-alpha
  • TIF1ATIF1ALPHA
  • TIF1TF1A
  • transcription intermediary factor 1-alpha
  • transcriptional intermediary factor 1
  • TRIM24
  • tripartite motif containing 24
  • tripartite motif-containing 24
  • Tripartite motif-containing protein 24

Background

The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 alpha Antibody (H00008805-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIF1 alpha Products

Research Areas for TIF1 alpha Antibody (H00008805-M01)

Find related products by research area.

Blogs on TIF1 alpha

There are no specific blogs for TIF1 alpha, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 alpha Antibody (2F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM24
Entrez
OMIM
Uniprot