| Reactivity | Hu, Mu, PoSpecies Glossary |
| Applications | WB, ICC/IF, IHC, MS |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TGFB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review. |
|
| Theoretical MW | 43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Armen Petrosyan |
IF | Mouse | 11/19/2024 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Michela Colombo |
IMC | Human | 11/12/2021 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 09/16/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TGF-beta 1 Antibody (NBP1-80289)Find related products by research area.
|
|
TGF-beta 1 - a versatile signaling molecule with roles in development and disease The transforming growth factor-beta (TGF-beta) family consists of a wide variety of signaling proteins with roles in development. TGF-beta signaling controls growth, differentiation, and immune responses and is often misregulated in cancer. TGF-beta ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Armen Petrosyan 11/19/2024 |
||
| Application: | IF | |
| Species: | Mouse |
| Michela Colombo 11/12/2021 |
||
| Application: | IMC | |
| Species: | Human |
| Verified Customer 09/16/2016 |
||
| Application: | IHC-P | |
| Species: | Human |