TGF-beta 1 Antibody

Images

 
Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Immunocytochemistry/ Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289] - Mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Appendix FFPE tissue section stained with TGF-beta 1 antibody. IHC-P image submitted by a verified customer review.
Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 Dilution. SP2/0 cell lysate.
Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Spleen. Antibody Dilution: 1ug/ml
Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Spleen Tissue, 5 ug/ml.
Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human prostate cancer tissue was detected using RP/AEC red color stain. Working dilutions: 5-10 ug/ml.
Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289] - Human bone marrow FFPE tissue sections. DNA in blue, TGF-beta 1 antibody staining in white. IMC image submitted by a verified customer review.

Product Details

Summary
Reactivity Hu, Mu, PoSpecies Glossary
Applications WB, ICC/IF, IHC, MS
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

TGF-beta 1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGFB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Imaging Mass Cytometry
  • Immunocytochemistry/ Immunofluorescence 5-10 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5-10 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-80289 in the following applications:

Publications
Read Publications using
NBP1-80289 in the following applications:

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 23616520).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TGF-beta 1 Antibody

  • CEDLAP
  • DPD1
  • latency-associated peptide
  • TGF beta
  • TGF beta1
  • TGFB
  • TGFB1
  • TGF-beta 1 protein
  • TGFbeta 1
  • TGF-beta 1
  • TGFbeta
  • TGF-beta-1
  • transforming growth factor beta-1
  • transforming growth factor, beta 1

Background

TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
233-FB
Species: Hu
Applications: BA
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
236-EG
Species: Hu
Applications: BA
NBP2-24951
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-80289
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, MS

Publications for TGF-beta 1 Antibody (NBP1-80289)(10)

We have publications tested in 3 confirmed species: Mouse, Rat, Porcine.

We have publications tested in 6 applications: ICC/IF, IF/IHC, IHC, IHC-P, In Vivo, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
IHC
(2)
IHC-P
(2)
In Vivo
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(4)
Rat
(1)
Porcine
(1)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-80289 Applications Species
Yamawaki Y, Parvez M, Wada Y et al. Environmental stress insults in 2HIT model synergistically produce disorder-associated microglia and macrophages in the cerebellum Research Square 2023-02-21 (IHC, Mouse) IHC Mouse
Medipally A, Xiao M, Satoskar AA et al. N-acetylcysteine ameliorates hematuria-associated tubulointerstitial injury in 5/6 nephrectomy mice Physiological reports 2023-07-01 [PMID: 37419616] (IHC-P, Mouse) IHC-P Mouse
Ma C, Wang L, Liao W et al. TGF- beta promotes stem-like T cells via enforcing their lymphoid tissue retention The Journal of experimental medicine 2022-10-03 [PMID: 35980385]
Nordquist EM, Dutta P, Kodigepalli KM et al. Tgf?1-Cthrc1 Signaling Plays an Important Role in the Short-Term Reparative Response to Heart Valve Endothelial Injury Arteriosclerosis, Thrombosis, and Vascular Biology 2021-12-01 [PMID: 34645278]
Yang JH, Ku SK, Cho ILJ et al. Neoagarooligosaccharide Protects against Hepatic Fibrosis via Inhibition of TGF-?/Smad Signaling Pathway International Journal of Molecular Sciences 2021-02-18 [PMID: 33670808] (In Vivo) In Vivo
Bashir AZ. Cathepsin L in unstable plaques Archives of Medical Science – Atherosclerotic Diseases 2020-05-21 [PMID: 32529107] (IHC, ICC/IF) IHC, ICC/IF
Chung S, Overstreet JM, Li Y et al. TGF-b promotes fibrosis after severe acute kidney injury by enhancing renal macrophage infiltration. JCI Insight. 2018-11-02 [PMID: 30385721] (WB, Mouse) WB Mouse
Herrmann J, Wohlert C, Saguner AM et al. Primary proteasome inhibition results in cardiac dysfunction. Eur J Heart Fail 2013-04-24 [PMID: 23616520] (WB, Porcine) WB Porcine
Nordquist EM Exploring Heart Valve Homeostasis and Repair Thesis 2021-01-01 (IHC-P, Mouse) IHC-P Mouse
Yao G, Mo X, Yin C et al. A programmable and skin temperature-activated electromechanical synergistic dressing for effective wound healing Science advances 2022-01-28 [PMID: 35080981] (IF/IHC, Rat) IF/IHC Rat

Reviews for TGF-beta 1 Antibody (NBP1-80289) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-80289:
Filter by Applications
IMC
(1)
IHC-P
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Imaging Mass Cytometry TGF-beta 1 NBP1-80289
Enlarge
4
reviewed by:
Michela Colombo
IMC Human 11/12/2021
View

Summary

ApplicationImaging Mass Cytometry
Sample Testedbone marrow
SpeciesHuman
Lotqc49893-190822

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.***
Immunohistochemistry-Paraffin TGF-beta 1 NBP1-80289
Enlarge
5
reviewed by:
Verified Customer
IHC-P Human 09/16/2016
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedAppendix FFPE section
SpeciesHuman
Lotqc49894-42474

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TGF-beta 1 Antibody (NBP1-80289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TGF-beta 1 Products

Diseases for TGF-beta 1 Antibody (NBP1-80289)

Discover more about diseases related to TGF-beta 1 Antibody (NBP1-80289).
 

Pathways for TGF-beta 1 Antibody (NBP1-80289)

View related products by pathway.

PTMs for TGF-beta 1 Antibody (NBP1-80289)

Learn more about PTMs related to TGF-beta 1 Antibody (NBP1-80289).
 

Research Areas for TGF-beta 1 Antibody (NBP1-80289)

Find related products by research area.

Blogs on TGF-beta 1.

TGF-beta 1 - a versatile signaling molecule with roles in development and disease
The transforming growth factor-beta (TGF-beta) family consists of a wide variety of signaling proteins with roles in development. TGF-beta signaling controls growth, differentiation, and immune responses and is often misregulated in cancer. TGF-beta ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Michela Colombo
11/12/2021
Application: IMC
Species: Human

Verified Customer
09/16/2016
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol TGFB1
Uniprot