Teneurin-1 Antibody - Azide and BSA Free

Western Blot: Teneurin-1 Antibody [NBP2-93336] - Analysis of extracts of various cell lines, using Teneurin-1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: Teneurin-1 Antibody [NBP2-93336] - Analysis of U-2 OS cells using Teneurin-1 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: Teneurin-1 Antibody [NBP2-93336] - Analysis of C6 cells using Teneurin-1 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Teneurin-1 Antibody - Azide and BSA Free [NBP2-93336] - Immunofluorescence analysis of L929 cells using Teneurin-1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Teneurin-1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Teneurin-1 Antibody - Azide and BSA Free (NBP2-93336) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1). QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TENM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 305 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Teneurin-1 Antibody - Azide and BSA Free

• odz, odd Oz/ten-m homolog 1(Drosophila)
• ODZ1
• ODZ3
• Protein Odd Oz/ten-m homolog 1
• Ten-1
• tenascin M
• tenascin M1
• Tenascin-M1
• teneurin 1
• Teneurin1
• Teneurin-1
• TEN-M1
• TNM
• TNM1

Background

Teneurin-1, also known as Teneurin Transmembrane Protein 1 or Ten-1, contains a 305 kDa and a 306 kDa isoform, and is involved in regulating the connections within the nervous system and neural development. Teneurin-1 is not currently being used in any disease research. The protein has not been found to interact with any other proteins, but is linked to transcription, stress and immune responses, and signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TENM1