MVD Antibody

Images

 
Western Blot: MVD Antibody [NBP2-13628] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MVD Antibody [NBP2-13628] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: MVD Antibody [NBP2-13628] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MVD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHAT CLDTFPPISYLNAISWRIIHLVHRFN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MVD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MVD Protein (NBP2-13628PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MVD Antibody

  • EC 4.1.1.33
  • FP17780
  • MDDase
  • mevalonate (diphospho) decarboxylase
  • Mevalonate (diphospho)decarboxylase
  • Mevalonate pyrophosphate decarboxylase
  • MPDdiphosphomevalonate decarboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-13628
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MVD Antibody (NBP2-13628) (0)

There are no publications for MVD Antibody (NBP2-13628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVD Antibody (NBP2-13628) (0)

There are no reviews for MVD Antibody (NBP2-13628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MVD Antibody (NBP2-13628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MVD Products

Bioinformatics Tool for MVD Antibody (NBP2-13628)

Discover related pathways, diseases and genes to MVD Antibody (NBP2-13628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVD Antibody (NBP2-13628)

Discover more about diseases related to MVD Antibody (NBP2-13628).
 

Pathways for MVD Antibody (NBP2-13628)

View related products by pathway.

PTMs for MVD Antibody (NBP2-13628)

Learn more about PTMs related to MVD Antibody (NBP2-13628).
 

Research Areas for MVD Antibody (NBP2-13628)

Find related products by research area.

Blogs on MVD

There are no specific blogs for MVD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MVD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MVD