MVD Antibody - BSA Free

Western Blot: MVD Antibody [NBP2-13628] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: MVD Antibody [NBP2-13628] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: MVD Antibody [NBP2-13628] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MVD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MVD Antibody - BSA Free (NBP2-13628) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MVD Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MVD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MVD Protein (NBP2-13628PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MVD Antibody - BSA Free

• EC 4.1.1.33
• FP17780
• MDDase
• mevalonate (diphospho) decarboxylase
• Mevalonate (diphospho)decarboxylase
• Mevalonate pyrophosphate decarboxylase
• MPDdiphosphomevalonate decarboxylase

Background

The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MVD Antibody (NBP2-13628)(1)

Publication using NBP2-13628

• Emanuele P, Emre A, Konstantin B et al. Cholesterol deprivation drives DHEA biosynthesis in human adrenals. Endocrinology. 2022-05-18 [PMID: 35583599]

Bioinformatics

• Gene Symbol: MVD