MVD Antibody


Western Blot: MVD Antibody [NBP2-13628] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MVD Antibody [NBP2-13628] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: MVD Antibody [NBP2-13628] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

MVD Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHAT CLDTFPPISYLNAISWRIIHLVHRFN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
MVD Protein (NBP2-13628PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Alternate Names for MVD Antibody

  • EC
  • FP17780
  • MDDase
  • mevalonate (diphospho) decarboxylase
  • Mevalonate (diphospho)decarboxylase
  • Mevalonate pyrophosphate decarboxylase
  • MPDdiphosphomevalonate decarboxylase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ChIP, ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, TCS, LA
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MVD Antibody (NBP2-13628) (0)

There are no publications for MVD Antibody (NBP2-13628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVD Antibody (NBP2-13628) (0)

There are no reviews for MVD Antibody (NBP2-13628). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MVD Antibody (NBP2-13628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MVD Antibody Products

Related Products by Gene

Bioinformatics Tool for MVD Antibody (NBP2-13628)

Discover related pathways, diseases and genes to MVD Antibody (NBP2-13628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVD Antibody (NBP2-13628)

Discover more about diseases related to MVD Antibody (NBP2-13628).

Pathways for MVD Antibody (NBP2-13628)

View related products by pathway.

PTMs for MVD Antibody (NBP2-13628)

Learn more about PTMs related to MVD Antibody (NBP2-13628).

Research Areas for MVD Antibody (NBP2-13628)

Find related products by research area.

Blogs on MVD

There are no specific blogs for MVD, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol MVD

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13628 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought