TDP-43/TARDBP Antibody

Images

 
Western Blot: TDP-43/TARDBP Antibody [NBP1-89116] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody [NBP1-89116] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody [NBP1-89116] - Staining of human epididymis shows distinct positivity in both nuclei and cytoplasm of glandular cells.
Western Blot: TDP-43/TARDBP Antibody [NBP1-89116] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDP-43/TARDBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TARDBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TDP-43/TARDBP Protein (NBP1-89116PEP)
Publications
Read Publications using NBP1-89116.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDP-43/TARDBP Antibody

  • ALS10
  • ALS10TAR DNA-binding protein-43
  • TAR DNA binding protein
  • TARDBP
  • TDP43
  • TDP-43
  • TDP-43TAR DNA-binding protein 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
AF2420
Species: Hu
Applications: WB, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
MAB7509
Species: Hu
Applications: WB, IHC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-93504
Species: Hu
Applications: IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TDP-43/TARDBP Antibody (NBP1-89116)(3)

Reviews for TDP-43/TARDBP Antibody (NBP1-89116) (0)

There are no reviews for TDP-43/TARDBP Antibody (NBP1-89116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TDP-43/TARDBP Antibody (NBP1-89116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDP-43/TARDBP Products

Bioinformatics Tool for TDP-43/TARDBP Antibody (NBP1-89116)

Discover related pathways, diseases and genes to TDP-43/TARDBP Antibody (NBP1-89116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDP-43/TARDBP Antibody (NBP1-89116)

Discover more about diseases related to TDP-43/TARDBP Antibody (NBP1-89116).
 

Pathways for TDP-43/TARDBP Antibody (NBP1-89116)

View related products by pathway.

PTMs for TDP-43/TARDBP Antibody (NBP1-89116)

Learn more about PTMs related to TDP-43/TARDBP Antibody (NBP1-89116).
 

Research Areas for TDP-43/TARDBP Antibody (NBP1-89116)

Find related products by research area.

Blogs on TDP-43/TARDBP

There are no specific blogs for TDP-43/TARDBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDP-43/TARDBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TARDBP
Entrez