TDP-43/TARDBP Antibody - BSA Free

Western Blot: TDP-43/TARDBP Antibody [NBP1-89116] - Analysis in human cell line SCLC-21H.

Immunocytochemistry/Immunofluorescence: TDP-43/TARDBP Antibody [NBP1-89116] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody [NBP1-89116] - Staining of human epididymis shows distinct positivity in both nuclei and cytoplasm of glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TDP-43/TARDBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TDP-43/TARDBP Antibody - BSA Free (NBP1-89116) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TDP-43/TARDBP Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNN
• Predicted Species: Mouse (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TARDBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TDP-43/TARDBP Protein (NBP1-89116PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TDP-43/TARDBP Antibody - BSA Free

• ALS10
• ALS10TAR DNA-binding protein-43
• TAR DNA binding protein
• TARDBP
• TDP43
• TDP-43
• TDP-43TAR DNA-binding protein 43

Background

TARDBP, also known as TAR DNA binding protein, is a DNA and RNA-binding protein which regulates transcription and splicing. TARDBP is also involved in the regulation of CFTR splicing and promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. TARD-BP may also be involved in microRNA biogenesis, apoptosis and cell division. TARDBP can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TDP-43/TARDBP Antibody (NBP1-89116)(3)

Publications using NBP1-89116

• Tyleckova J, Hrabakova R, Mairychova K et al. Cancer Cell Response to Anthracyclines Effects: Mysteries of the Hidden Proteins Associated with These Drugs. Int J Mol Sci 2012-11-22 [PMID: 23443080]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Sharma M, Burre J, Sudhof TC et al. CSP? promotes SNARE-complex assembly by chaperoning SNAP-25 during synaptic activity. Nat Cell Biol 2011-01-01 [PMID: 21151134]

Bioinformatics

• Gene Symbol: TARDBP