Home » Optineurin » Optineurin Antibodies » Optineurin Antibody

Optineurin Antibody

 (1 Publication)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Orthogonal Strategies: Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Independent Antibodies: Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).
Immunocytochemistry/ Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant ...read more
Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of Optineurin antibody on mouse retina (frozen sections) by Celia McKee, Duke University. 20X and 100X.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Optineurin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in the literature (PMID:24943399). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Optineurin antibody validated for IHC-FR from a verified customer review.
Control Peptide
Optineurin Protein (NBP1-84682PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-84682 in the following applications:
Publications
Read Publication using
NBP1-84682 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24943399). Reactivity reported in mouse retina from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Optineurin Antibody

  • ALS12
  • FIP2
  • FIP2FIP-2
  • GLC1E
  • GLC1Eglaucoma 1, open angle, E (adult-onset)
  • HIP7
  • HIP7ALS12
  • Huntingtin interacting protein L
  • Huntingtin yeast partner L
  • Huntingtin-interacting protein 7
  • Huntingtin-interacting protein L
  • HYPL
  • HYPLHIP-7
  • NEMO-related protein
  • NRP
  • NRPE3-14.7K-interacting protein
  • Optic neuropathy-inducing protein
  • Optineurin
  • OPTN
  • TFIIIA-INTP
  • Transcription factor IIIA-interacting protein
  • transcrption factor IIIA-interacting protein
  • tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myocilin Antibody
(297817)
MAB3446
Myocilin Antibody (297817)
(1 Review)
(6 Publications)
Species: Hu
Applications: WB
Neuropilin-1
Antibody [Unconjugate
AF566
Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (hippocampus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (thalamus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows 25 ng of Recombinant Mouse Neuropilin‑1 (Catalog # 5994-N1), Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) and Recombinant Human Neuropilin‑1 (Catalog # 3870-N1). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Neuropilin‑1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(12 Reviews)
(50 Publications)
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
Neuropilin-2
Antibody [Unconjugate
AF2215
Neuropilin‑2 was detected in immersion fixed paraffin-embedded sections of human pancreatic cancer tissue using Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF2215) at 5 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HUVEC human umbilical vein endothelial cells. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Neuropilin‑2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HUVEC human umbilical vein endothelial cells, C6 rat glioma cell line, LL/2 mouse Lewis lung carcinoma cell line, and bEnd.3 mouse endothelioma cell line, loaded at 0.2 mg/mL. A specific band was detected for Neuropilin‑2 at approximately 140 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, Simple Western, WB
WDR36 Antibody
(1D6)
H00134430-M01
Sandwich ELISA: WDR36 Antibody (1D6) [H00134430-M01] - Detection limit for recombinant GST tagged WDR36 is approximately 0.3ng/ml as a capture antibody.
(3 Publications)
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DAB
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of mouse renal cells carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DA
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
(4 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NELL1 Antibody
AF7109
Western blot shows lysates of Neuro‑2A mouse neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse NELL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7109) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NELL1 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NELL1 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Sheep Anti-Mouse NELL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7109) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neurons in the spinal cord. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: IHC, WB
RAB8A Antibody
(3G1)
H00004218-M02
Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.
ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
(1 Review)
(9 Publications)
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NELL2 Antibody
NBP1-82527
Immunohistochemistry: NELL2 Antibody [NBP1-82527] - NELL2 expression in the 3% PFA perfused mouse brain Hippocampus and Cortex using primary antibody with 1:100 dilution. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human placenta shows very weak cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CYP1B1 Antibody
NBP2-24722
Immunohistochemistry-Paraffin: CYP1B1 Antibody [NBP2-24722] - Analysis of CYP1B1 in human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Western Blot: CYP1B1 Antibody [NBP2-24722] - Analysis of CYP1B1 in human brain lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: CYP1B1 Antibody [NBP2-24722] - Analysis of human adrenal using this antibody at 10 ug/ml.
(1 Review)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Huntingtin Antibody
NBP3-13106
Western Blot: Huntingtin Antibody [NBP3-13106] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Huntingtin antibody (NBP3-13106) diluted at 1:1000.
Immunohistochemistry-Paraffin: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm in rat brain by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. Huntingtin antibody (NBP3-13106) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm by immunofluorescent analysis. Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Huntingtin protein stained by Huntingtin antibody (NBP3-13106) diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TDP-43/TARDBP
Antibody (2E2-D3)
H00023435-M01
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K TDP-43-mCherry from Neuro2a cell lysates using an anti-PDI antibody followed by TDP-43 immunoblot. Control immunoprecipitations were performed using untransfected (Untrans) or mCherry expressing cell lysates, buffer only with coprecipitating antibodies or TDP-43 Q331K cell lysates using an irrelevant, isotype-matched control antibody (IgG). Input control (2%) shows expression of mCherry-TDP43 in wildtype and Q331K cell lysates. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0081170) licensed under a CC-BY licence.
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.Lane 1: TARDBP transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP in rat tissue samples. Image courtsey of product review by Daniel Pirici.
(3 Reviews)
(175 Publications)
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
ALS Antibody
[Unconjugated]
AF1436
Western blot shows lysates of mouse spleen tissue, mouse liver tissue, and mouse bone marrow. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse IGFALS/ALS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1436) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFALS/ALS at approximately 80-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB as shown by EMSA. U266 cells were treated with 100 uM of control or NBD peptide for different time periods. Nuclear extracts were isolated and checked for NF-kB-DNA binding activity.
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB activation in human multiple myeloma cells. U266 cells were treated with 100 uM of control (A & B) or NBD peptide (C & D) for 12 hr, cytospun, plated on glass slides, air dried for 1 hr at room temperature and fixed with cold acetone. Slides were blocked with 5% normal goat serum for 1 hr and then incubated with rabbit polyclonal anti-human p65 antibody (A & C) followed by Ig-Alexa 594 second step. In control peptide treated cells, p65 translocates to nucleus (A), whereas NBD peptide prevents translocation of p65 into the nucleus (C). B & D: Nuclear staining with DNA binding dye.
IKK gamma Inhibitor Peptide Set [NBP2-26504] - The IKK complex consists of IKKalpha + IKKbeta+ NEMO. NEMO (IKKgamma/NF-kB Essential MOdulator) is a scaffold protein required for the kinase activity of IKKalpha + IKKbeta. NBD (NEMO Binding Domain) inhibits formation of the IKK complex (IKKalpha + IKKbeta+ NEMO) by binding to NEMO and blocking IKK complex formation. In this regard, NBD is considered to be an 'IKKalpha and IKKBeta decoy' Blocking IKK complex formation suppresses downstream events in the NF-kB signaling pathway that rely on the IKK complex including phosphorylation of IkBalpha, and subsequence IkBalpha ubiquination, degradation and release of NF-kB. Hence, NF-kB is retained in the cytoplasm in its inactive state.
(23 Publications)
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
TBK1 Antibody
(108A429) - BSA Free
NB100-56705
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Analysis of FFPE human testis tissue section using Peripheral Node Addressin antibody (clone MECA-79R) at 1:200. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Simple Western: TBK1 Antibody (108A429) [NB100-56705] - Lane view shows a specific band for NAK/TBK1 in 0.5 mg/ml of Daudi (left) and Raw 264.7 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody
(2 Reviews)
(29 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
MYO6 Antibody
(2E12)
H00004646-M02
Western Blot: MYO6 Antibody (2E12) [H00004646-M02] - MYO6 monoclonal antibody (M02), clone 2E12. Analysis of MYO6 expression in MCF-7.
Sandwich ELISA: MYO6 Antibody (2E12) [H00004646-M02] - Detection limit for recombinant GST tagged MYO6 is 0.3 ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Optineurin Antibody
NBP1-84682
Optineurin Antibody
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Optineurin Antibody (NBP1-84682)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Optineurin Antibody (NBP1-84682) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-84682:
Filter by Applications
Western Blot
(1)
Immunohistochemistry-Frozen
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Optineurin NBP1-84682
Enlarge 		5
reviewed by:
Jack Vidani
 Western Blot Mouse 02/20/2018
View

Summary

ApplicationWestern Blot
Sample TestedProtein Lysate
SpeciesMouse
LotC114003
Immunohistochemistry-Frozen Optineurin NBP1-84682
Enlarge 		5
reviewed by:
Verified Customer
 Immunohistochemistry-Frozen Mouse 08/16/2014
View

Summary

ApplicationImmunohistochemistry-Frozen
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Optineurin Antibody (NBP1-84682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Optineurin Products

Bioinformatics Tool for Optineurin Antibody (NBP1-84682)

Discover related pathways, diseases and genes to Optineurin Antibody (NBP1-84682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Optineurin Antibody (NBP1-84682)

Discover more about diseases related to Optineurin Antibody (NBP1-84682).
 

Pathways for Optineurin Antibody (NBP1-84682)

View related products by pathway.

PTMs for Optineurin Antibody (NBP1-84682)

Learn more about PTMs related to Optineurin Antibody (NBP1-84682).
 

Research Areas for Optineurin Antibody (NBP1-84682)

Find related products by research area.

Blogs on Optineurin

There are no specific blogs for Optineurin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0
Western Blot Optineurin NBP1-84682
Enlarge
 Jack Vidani
02/20/2018
Application: Western Blot
Species: Mouse
read this review
Immunohistochemistry-Frozen Optineurin NBP1-84682
Enlarge
 Verified Customer
08/16/2014
Application: Immunohistochemistry-Frozen
Species: Mouse
read this review

Bioinformatics

Gene Symbol OPTN