Optineurin Antibody

Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).

Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.

Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant Tau 3. N2a cells + mutant tau + Drp1 full length + mutant Tau. This image was submitted via customer review.

Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of Optineurin antibody on mouse retina (frozen sections) by Celia McKee, Duke University. 20X and 100X.

Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Optineurin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OPTN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in the literature (PMID:24943399). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Optineurin antibody validated for IHC-FR from a verified customer review.
• Control Peptide:

  Optineurin Protein (NBP1-84682PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24943399). Reactivity reported in mouse retina from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Optineurin Antibody

• ALS12
• FIP2
• FIP2FIP-2
• GLC1E
• GLC1Eglaucoma 1, open angle, E (adult-onset)
• HIP7
• HIP7ALS12
• Huntingtin interacting protein L
• Huntingtin yeast partner L
• Huntingtin-interacting protein 7
• Huntingtin-interacting protein L
• HYPL
• HYPLHIP-7
• NEMO-related protein
• NRP
• NRPE3-14.7K-interacting protein
• Optic neuropathy-inducing protein
• Optineurin
• OPTN
• TFIIIA-INTP
• Transcription factor IIIA-interacting protein
• transcrption factor IIIA-interacting protein
• tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains

Background

Optineurin encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Optineurin Antibody (NBP1-84682)(2)

Publications using NBP1-84682

• Huang KC, Gomes C, Shiga Y et al. Autophagy disruption reduces mTORC1 activation leading to retinal ganglion cell neurodegeneration associated with glaucoma bioRxiv : the preprint server for biology 2023-01-04 [PMID: 36711831] (ICC/IF, WB, Human)
  
  Details:
  Dilution used in WB 1:1,000, ICC 1:200
• Smith AM, Sewell GW, Levine AP et al. Disruption of macrophage pro-inflammatory cytokine release in Crohns disease is associated with reduced optineurin expression in a subset of patients. Immunology 2015-01-01 [PMID: 24943399] (WB, Human)

Reviews for Optineurin Antibody (NBP1-84682) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Jack Vidani WB Mouse 02/20/2018

Summary

• Application: Western Blot
• Sample Tested: Protein Lysate
• Species: Mouse
• Lot: C114003

reviewed by: Verified Customer IHC-Fr Mouse 08/16/2014

Summary

• Application: Immunohistochemistry-Frozen
• Species: Mouse

Bioinformatics

• Gene Symbol: OPTN