RBM8A Antibody

Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RBM8A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM8A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM8A Protein (NBP1-88376PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31672445).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM8A Antibody

• Binder of OVCA1-1
• BOV-1
• BOV-1A
• BOV-1B
• BOV-1C
• MDS014
• RBM8BRBM8
• ribonucleoprotein RBM8
• Ribonucleoprotein RBM8A
• RNA binding motif protein 8A
• RNA binding motif protein 8B
• RNA-binding motif protein 8A
• RNA-binding protein 8A
• RNA-binding protein Y14
• Y14
• ZNRP
• ZRNP1

Background

Pre-mRNA splicing appears to play an important role in regulation of gene expression. It has been shown in a number of studies that during the splicing process, specific proteins are recruited to the mRNA and assemble into a complex of mRNA-protein near the exon-exon junction. This complex is termed mRNA-protein complex (mRNP), or the exon-exon junction complex. Several proteins were found to be present in this complex including Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK. Y14 is a 174 amino acid RNA-binding protein that contains one RNA-binding domain in the middle of the protein. Y14 binds to the spliced mRNAs in the nucleus and is exported with the mRNA to the cytoplasm. Similar to other proteins in the mRNA-protein complex, Y14 can interact with the mRNA export factor TAP and enhance the export of the mRNAs. Y14 binds to different mRNAs approx.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM8A Antibody (NBP1-88376)(2)

Publications using NBP1-88376

• Ghemrawi R, Arnold C, Battaglia-Hsu SF et al. SIRT1 activation rescues the mislocalization of RNA-binding proteins and cognitive defects induced by inherited cobalamin disorders Metab. Clin. Exp. 2019-10-28 [PMID: 31672445] (WB, ICC/IF, Mouse)
• Singh KK, Wachsmuth L, Kulozik AE et al. Two mammalian MAGOH genes contribute to exon junction complex composition and nonsense-mediated decay. RNA Biol 2013-08-01 [PMID: 23917022]

Bioinformatics

• Gene Symbol: RBM8A