Home » RBM8A » RBM8A Antibodies » RBM8A Antibody

RBM8A Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in human cell line MCF-7.
Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.
Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Genetic Strategies: Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative ...read more

Product Details

Summary
Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

RBM8A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Specificity
Specificity of human RBM8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using
NBP1-88376 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31672445).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM8A Antibody

  • Binder of OVCA1-1
  • BOV-1
  • BOV-1A
  • BOV-1B
  • BOV-1C
  • MDS014
  • RBM8BRBM8
  • ribonucleoprotein RBM8
  • Ribonucleoprotein RBM8A
  • RNA binding motif protein 8A
  • RNA binding motif protein 8B
  • RNA-binding motif protein 8A
  • RNA-binding protein 8A
  • RNA-binding protein Y14
  • Y14
  • ZNRP
  • ZRNP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human testis show strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
46420002
ELISA: TAT Antibody [46420002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
Cyclin T1 Antibody
NBP2-81898
Western Blot: Cyclin T1 Antibody [NBP2-81898] - Analysis of Cyclin T1 in rat brain tissue lysate with Cyclin T1 antibody at 1 ug/ml in (A) the absence and (B) presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: Cyclin T1 Antibody [NBP2-81898] - Analysis of Cyclin T1 in rat brain tissue with Cyclin T1 antibody at 20 ug/ml.
Immunohistochemistry: Cyclin T1 Antibody [NBP2-81898] - Analysis of Cyclin T1 in rat brain tissue with Cyclin T1 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
TDP-43/TARDBP
Antibody (2E2-D3)
H00023435-M01
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP monoclonal antibody (M01), clone 2E2-D3 Analysis of TARDBP expression in A-431.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP in rat tissue samples. Image courtsey of product review by Daniel Pirici.
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K TDP-43-mCherry from Neuro2a cell lysates using an anti-PDI antibody followed by TDP-43 immunoblot. Control immunoprecipitations were performed using untransfected (Untrans) or mCherry expressing cell lysates, buffer only with coprecipitating antibodies or TDP-43 Q331K cell lysates using an irrelevant, isotype-matched control antibody (IgG). Input control (2%) shows expression of mCherry-TDP43 in wildtype and Q331K cell lysates. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0081170) licensed under a CC-BY licence.
(2 Reviews)
(173 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
TRBP Antibody
NBP2-24725
Western Blot: TRBP Antibody [NBP2-24725] - Analysis of TRBP in human brain lysate in the 1) absence, 2) presence of immunizing peptide using this antibody at 6 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using this antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using control (rabbit Ig) at 5 ug/ml.
(1 Publication)
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
Mago nashi homolog
2 Antibody
H00055110-B01P
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.
Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA, ICC/IF
Cdk9 Antibody
(SD204-07)
NBP2-67811
Western Blot: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of Cdk9 on different lysates using anti-Cdk9 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: A431
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of paraffin-embedded human tonsil tissue using anti-Cdk9 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
FUS Antibody
NB100-565
Knockout Validated: FUS Antibody [NB100-565] - Western blot shows lysates of HEK293 human embryonic kidney parental cell line and FUS knockout (KO) HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human FUS Polyclonal Antibody (Catalog # NB100-565) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FUS at approximately 75 kDa (as indicated) in the parental HEK293 celll line, but is not detectable in the knockout HEK293 cell line. This experiment was conducted under reducing conditions.
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
Immunocytochemistry/Immunofluorescence: FUS Antibody [NB100-565] - FUS (NB100-565) (green), b-III Tubulin (white), DAPI (blue). FUS antibody dilution: 1:300 in PBST (0.1% Triton X-100) + 10% GS O/N 4C. ICC/IF image submitted by a verified customer review.
(3 Reviews)
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
Progranulin/PGRN
Antibody [Unconjugate ...
AF2557
Western blot shows lysates of mouse uterus tissue and J774A.1 mouse reticulum cell sarcoma macrophage cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Progranulin/PGRN at approximately 85‑90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Progranulin/PGRN was detected in immersion fixed mouse splenocytes using Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Progranulin was detected in immersion fixed frozen sections of mouse kidney using Sheep Anti-Mouse Progranulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(19 Publications)
Species: Mu
Applications: WB, IHC, ICC
MAGOH Antibody
(6E11)
H00004116-M01
Western Blot: MAGOH Antibody (6E11) [H00004116-M01] - MAGOH monoclonal antibody (M01), clone 6E11. Analysis of MAGOH expression in HeLa.
Immunocytochemistry/Immunofluorescence: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of monoclonal antibody to MAGOH on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M01), clone 6E11.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA, ICC/IF
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Aly Antibody
NBP1-33598
Western Blot: Aly Antibody [NBP1-33598] - Sample (30 ug of whole cell lysate) A: Molt-4 12% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Aly Antibody [NBP1-33598] - Paraformaldehyde-fixed HeLa, using Aly (NBP1-33598) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Aly Antibody [NBP1-33598] - Human esophageal cancer ALY antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
CASC3 Antibody
NBP1-30321
Immunohistochemistry: CASC3 Antibody [NBP1-30321] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CASC3 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Immunoprecipitation: CASC3 Antibody [NBP1-30321] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CASC3 used for IP at 3 mcg/mg lysate. CASC3 was also immunoprecipitated by another rabbit anti-CASC3 antibody, which recognizes a downstream epitope.
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NXF1 Antibody
NBP1-31649
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
EIF4A3 Antibody
(JG35-33)
NBP2-76831
Western Blot: EIF4A3 Antibody (JG35-33) [NBP2-76831] - Western blot analysis of eIF4A3 on SiHa cell lysates using anti-eIF4A3 at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody (JG35-33) [NBP2-76831] - ICC staining eIF4A3 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: EIF4A3 Antibody (JG35-33) [NBP2-76831] - Immunohistochemical analysis of paraffin-embedded mouse skin tissue using anti-eIF4A3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
PSG1 [HRP]
DPSG10
(1 Publication)
Species: Hu

Publications for RBM8A Antibody (NBP1-88376)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RBM8A Antibody (NBP1-88376) (0)

There are no reviews for RBM8A Antibody (NBP1-88376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM8A Antibody (NBP1-88376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RBM8A Products

Bioinformatics Tool for RBM8A Antibody (NBP1-88376)

Discover related pathways, diseases and genes to RBM8A Antibody (NBP1-88376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM8A Antibody (NBP1-88376)

Discover more about diseases related to RBM8A Antibody (NBP1-88376).
 

Pathways for RBM8A Antibody (NBP1-88376)

View related products by pathway.

PTMs for RBM8A Antibody (NBP1-88376)

Learn more about PTMs related to RBM8A Antibody (NBP1-88376).

Blogs on RBM8A

There are no specific blogs for RBM8A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM8A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM8A
COVID-19 update