RBM8A Antibody

Images

 
Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM8A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM8A Protein (NBP1-88376PEP)
Publications
Read Publication using NBP1-88376.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23917022)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM8A Antibody

  • Binder of OVCA1-1
  • BOV-1
  • BOV-1A
  • BOV-1B
  • BOV-1C
  • MDS014
  • RBM8BRBM8
  • ribonucleoprotein RBM8
  • Ribonucleoprotein RBM8A
  • RNA binding motif protein 8A
  • RNA binding motif protein 8B
  • RNA-binding motif protein 8A
  • RNA-binding protein 8A
  • RNA-binding protein Y14
  • Y14
  • ZNRP
  • ZRNP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
H00000904-Q01
Species: Hu
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2420
Species: Hu
Applications: WB, IHC
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC

Publications for RBM8A Antibody (NBP1-88376)(1)

Reviews for RBM8A Antibody (NBP1-88376) (0)

There are no reviews for RBM8A Antibody (NBP1-88376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM8A Antibody (NBP1-88376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM8A Products

Bioinformatics Tool for RBM8A Antibody (NBP1-88376)

Discover related pathways, diseases and genes to RBM8A Antibody (NBP1-88376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM8A Antibody (NBP1-88376)

Discover more about diseases related to RBM8A Antibody (NBP1-88376).
 

Pathways for RBM8A Antibody (NBP1-88376)

View related products by pathway.

PTMs for RBM8A Antibody (NBP1-88376)

Learn more about PTMs related to RBM8A Antibody (NBP1-88376).

Blogs on RBM8A

There are no specific blogs for RBM8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM8A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM8A