![Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize2/RBM8A-Antibody-Western-Blot-NBP1-88376-img0007.jpg "Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in human cell line MCF-7.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV |
| Specificity | Specificity of human RBM8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM8A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88376 | Applications | Species |
|---|---|---|
| Singh KK, Wachsmuth L, Kulozik AE et al. Two mammalian MAGOH genes contribute to exon junction complex composition and nonsense-mediated decay. RNA Biol 2013 Aug [PMID: 23917022] |
Secondary Antibodies |
Isotype Controls |
Diseases for RBM8A Antibody (NBP1-88376)Discover more about diseases related to RBM8A Antibody (NBP1-88376).
| Pathways for RBM8A Antibody (NBP1-88376)View related products by pathway.
|
PTMs for RBM8A Antibody (NBP1-88376)Learn more about PTMs related to RBM8A Antibody (NBP1-88376).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM8A |
![Immunocytochemistry/Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://images.novusbio.com/fullsize2/RBM8A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88376-img0006.jpg "Immunocytochemistry/Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.")
![Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.](http://images.novusbio.com/fullsize2/RBM8A-Antibody-Immunohistochemistry-Paraffin-NBP1-88376-img0001.jpg "Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.")
![Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/RBM8A-Antibody-Western-Blot-NBP1-88376-img0005.jpg "Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/RBM8A Antibody-Western Blot-NBP1-88376-img0008.jpg "Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize2/ATAT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48990-img0002.jpg)
![Immunohistochemistry: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize2/ATAT1-Antibody-Immunohistochemistry-NBP2-48990-img0001.jpg)
![ELISA: TAT Antibody [46420002]](http://images.novusbio.com/fullsize/46420002-T01644A01.jpg)
![Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP monoclonal antibody (M01), clone 2E2-D3 Analysis of TARDBP expression in A-431.](http://images.novusbio.com/fullsize2/TDP-43-TARDBP-Antibody-(2E2-D3)-Western-Blot-H00023435-M01-img0025.jpg)
![Immunocytochemistry/Immunofluorescence: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/TDP-43-TARDBP-Antibody-(2E2-D3)-Immunocytochemistry-Immunofluorescence-H00023435-M01-img0019.jpg)
![Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/TDP-43-TARDBP-Antibody-(2E2-D3)-Immunohistochemistry-Paraffin-H00023435-M01-img0021.jpg)
![Western Blot: TRBP Antibody [NBP2-24725] - Analysis of TRBP in human brain lysate in the 1) absence, 2) presence of immunizing peptide using this antibody at 6 ug/ml.](http://images.novusbio.com/fullsize2/TRBP Antibody-Western Blot-NBP2-24725-img0001.jpg)
![Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using this antibody at 5 ug/ml.](http://images.novusbio.com/fullsize2/TRBP Antibody-Immunohistochemistry-Paraffin-NBP2-24725-img0003.jpg)
![Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using control (rabbit Ig) at 5 ug/ml.](http://images.novusbio.com/fullsize2/TRBP Antibody-Immunohistochemistry-Paraffin-NBP2-24725-img0002.jpg)
![Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.](http://images.novusbio.com/fullsize2/Mago-nashi-homolog-2-Antibody-Western-Blot-H00055110-B01P-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize2/Mago-nashi-homolog-2-Antibody-Immunocytochemistry-Immunofluorescence-H00055110-B01P-img0004.jpg)
![Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/Mago nashi homolog 2 Antibody-Western Blot-H00055110-B01P-img0006.jpg)
![Western Blot: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of Cdk9 on different lysates using anti-Cdk9 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: A431](http://images.novusbio.com/fullsize2/Cdk9-Antibody-(SD204-07)-Western-Blot-NBP2-67811-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/Cdk9 Antibody (SD204-07)-Immunocytochemistry-Immunofluorescence-NBP2-67811-img0008.jpg)
![Immunohistochemistry-Paraffin: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of paraffin-embedded human tonsil tissue using anti-Cdk9 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/Cdk9-Antibody-(SD204-07)-Immunohistochemistry-Paraffin-NBP2-67811-img0006.jpg)
![Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.](http://images.novusbio.com/fullsize2/SOD1-Cu-Zn-SOD-Antibody-Western-Blot-NBP2-24915-img0004.jpg)
![Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.](http://images.novusbio.com/fullsize2/SOD1-Cu-Zn-SOD-Antibody-Immunohistochemistry-Paraffin-NBP2-24915-img0003.jpg)
![Western Blot: FUS Antibody [NBP1-89113] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-FUS antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize2/FUS-Antibody-Western-Blot-NBP1-89113-img0029.jpg)
![Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP1-89113] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/FUS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89113-img0028.jpg)
![Immunohistochemistry-Paraffin: FUS Antibody [NBP1-89113] - Staining in human endometrium and liver tissues. Corresponding FUS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/FUS-Antibody-Immunohistochemistry-Paraffin-NBP1-89113-img0027.jpg)
![Western Blot: MAGOH Antibody (6E11) [H00004116-M01] - MAGOH monoclonal antibody (M01), clone 6E11. Analysis of MAGOH expression in HeLa.](http://images.novusbio.com/fullsize2/MAGOH-Antibody-(6E11)-Western-Blot-H00004116-M01-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of monoclonal antibody to MAGOH on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/MAGOH-Antibody-(6E11)-Immunocytochemistry-Immunofluorescence-H00004116-M01-img0004.jpg)
![Western Blot: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M01), clone 6E11.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/MAGOH Antibody (6E11)-Western Blot-H00004116-M01-img0007.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/fullsize2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/fullsize2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Western Blot: Aly Antibody [NBP1-33598] - Sample (30 ug of whole cell lysate) A: Molt-4 12% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/Aly Antibody-Western Blot-NBP1-33598-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Aly Antibody [NBP1-33598] - Paraformaldehyde-fixed HeLa, using Aly (NBP1-33598) antibody at 1:200 dilution.](http://images.novusbio.com/fullsize2/Aly Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33598-img0003.jpg)
![Immunohistochemistry-Paraffin: Aly Antibody [NBP1-33598] - Human esophageal cancer ALY antibody diluted at 1:500.](http://images.novusbio.com/fullsize2/Aly-Antibody-Immunohistochemistry-Paraffin-NBP1-33598-img0009.jpg)
![Western Blot: CRAT Antibody [NBP1-86615] - Analysis using Anti-CRAT antibody NBP1-86615 (A) shows similar pattern to independent antibody NBP1-86616 (B).](http://images.novusbio.com/fullsize2/CRAT-Antibody-Western-Blot-NBP1-86615-img0009.jpg)
![Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize2/CRAT-Antibody-Immunohistochemistry-Paraffin-NBP1-86615-img0007.jpg)
![Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/CRAT-Antibody-Western-Blot-NBP1-86615-img0008.jpg)
![Western Blot: GLYAT Antibody [NBP2-55298] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/GLYAT-Antibody-Western-Blot-NBP2-55298-img0002.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human liver.](http://images.novusbio.com/fullsize2/GLYAT Antibody-Immunohistochemistry-Paraffin-NBP2-55298-img0008.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize2/GLYAT-Antibody-Immunohistochemistry-Paraffin-NBP2-55298-img0003.jpg)
![Immunohistochemistry: CASC3 Antibody [NBP1-30321] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CASC3 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.](http://images.novusbio.com/fullsize2/CASC3 Antibody-Immunohistochemistry-NBP1-30321-img0004.jpg)
![Immunoprecipitation: CASC3 Antibody [NBP1-30321] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CASC3 used for IP at 3 mcg/mg lysate. CASC3 was also immunoprecipitated by another rabbit anti-CASC3 antibody, which recognizes a downstream epitope.](http://images.novusbio.com/fullsize2/CASC3-Antibody-Immunoprecipitation-NBP1-30321-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP2-49341] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/NXF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49341-img0003.jpg)
![Immunohistochemistry-Paraffin: NXF1 Antibody [NBP2-49341] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/NXF1-Antibody-Immunohistochemistry-Paraffin-NBP2-49341-img0002.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.](http://images.novusbio.com/fullsize2/Tau [p Thr181] Antibody-Western Blot-NB100-82245-img0001.jpg)
![Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.](http://images.novusbio.com/fullsize2/Tau-[p-Thr181]-Antibody-Immunohistochemistry-Paraffin-NB100-82245-img0005.jpg)
![Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).](http://images.novusbio.com/fullsize2/Tau [p Thr181] Antibody-Western Blot-NB100-82245-img0003.jpg)
![Western Blot: EIF4A3 Antibody [NBP1-85268] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/EIF4A3-Antibody-Western-Blot-NBP1-85268-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody [NBP1-85268] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/EIF4A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85268-img0011.jpg)
![Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining in human testis and pancreas tissues using anti-EIF4A3 antibody. Corresponding EIF4A3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/EIF4A3-Antibody-Immunohistochemistry-Paraffin-NBP1-85268-img0010.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")