Home » RBM8A » RBM8A Antibodies » RBM8A Antibody

RBM8A Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

RBM8A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM8A Protein (NBP1-88376PEP)
Publications
Read Publications using
NBP1-88376 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31672445).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM8A Antibody

  • Binder of OVCA1-1
  • BOV-1
  • BOV-1A
  • BOV-1B
  • BOV-1C
  • MDS014
  • RBM8BRBM8
  • ribonucleoprotein RBM8
  • Ribonucleoprotein RBM8A
  • RNA binding motif protein 8A
  • RNA binding motif protein 8B
  • RNA-binding motif protein 8A
  • RNA-binding protein 8A
  • RNA-binding protein Y14
  • Y14
  • ZNRP
  • ZRNP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot: TAT Antibody [NBP1-79286] - Rat Brain Lysate 1.0 ug/ml, gel concentration 12%
(1 Review)
Species: Rt
Applications: WB
Cyclin T1 Antibody
NBP3-05509
Immunocytochemistry/Immunofluorescence: Cyclin T1 Antibody [NBP3-05509] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TDP-43/TARDBP
Antibody (2E2-D3)
H00023435-M01
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K TDP-43-mCherry from Neuro2a cell lysates using an anti-PDI antibody followed by TDP-43 immunoblot. Control immunoprecipitations were performed using untransfected (Untrans) or mCherry expressing cell lysates, buffer only with coprecipitating antibodies or TDP-43 Q331K cell lysates using an irrelevant, isotype-matched control antibody (IgG). Input control (2%) shows expression of mCherry-TDP43 in wildtype and Q331K cell lysates. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0081170) licensed under a CC-BY licence.
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.Lane 1: TARDBP transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP in rat tissue samples. Image courtsey of product review by Daniel Pirici.
(3 Reviews)
(174 Publications)
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
TRBP Antibody
NBP2-24725
Western Blot: TRBP Antibody [NBP2-24725] - Analysis of TRBP in human brain lysate in the 1) absence, 2) presence of immunizing peptide using this antibody at 6 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using control (rabbit Ig) at 5 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using this antibody at 5 ug/ml.
(1 Publication)
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
Mago nashi homolog
2 Antibody
H00055110-B01P
Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.
Species: Hu
Applications: ICC/IF, WB
Cdk9 Antibody
(SD204-07)
NBP2-67811
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Cdk9 antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(9 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DAB
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of mouse renal cells carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DA
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
(4 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Progranulin/PGRN
Antibody [Unconjugate ...
AF2557
Western blot shows lysates of mouse uterus tissue and J774A.1 mouse reticulum cell sarcoma macrophage cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Progranulin/PGRN at approximately 85‑90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Progranulin was detected in immersion fixed frozen sections of mouse kidney using Sheep Anti-Mouse Progranulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Progranulin/PGRN was detected in immersion fixed mouse splenocytes using Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(7 Reviews)
(25 Publications)
Species: Mu
Applications: ICC, IHC, WB
MAGOH Antibody
(6E11)
H00004116-M01
Western Blot: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M01), clone 6E11.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MAGOH Antibody (6E11) [H00004116-M01] - Analysis of monoclonal antibody to MAGOH on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: MAGOH Antibody (6E11) [H00004116-M01] - Detection limit for recombinant GST tagged MAGOH is approximately 3ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Aly Antibody
NBP1-90179
Immunocytochemistry/Immunofluorescence: Aly Antibody [NBP1-90179] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Western Blot: Aly Antibody [NBP1-90179] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Western Blot: Aly Antibody [NBP1-90179] - Analysis in control (vector only transfected HEK293T lysate) and ALYREF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
CASC3 Antibody
NBP1-30321
Immunohistochemistry: CASC3 Antibody [NBP1-30321] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CASC3 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit .
Immunoprecipitation: CASC3 Antibody [NBP1-30321] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CASC3 used for IP at 3 mcg/mg lysate. CASC3 was also immunoprecipitated by another rabbit anti-CASC3 antibody, which recognizes a downstream epitope.
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NXF1 Antibody
NBP1-31649
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
EIF4A3 Antibody
(JG35-33)
NBP2-76831
Western Blot: EIF4A3 Antibody (JG35-33) [NBP2-76831] - Western blot analysis of eIF4A3 on SiHa cell lysates using anti-eIF4A3 at 1/500 dilution.
Immunohistochemistry: EIF4A3 Antibody (JG35-33) [NBP2-76831] - Immunohistochemical analysis of paraffin-embedded human tonsil tissue using anti-eIF4A3 antibody. Counter stained with hematoxylin.
Immunohistochemistry: EIF4A3 Antibody (JG35-33) [NBP2-76831] - Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-eIF4A3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
Applications: ELISA

Publications for RBM8A Antibody (NBP1-88376)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RBM8A Antibody (NBP1-88376) (0)

There are no reviews for RBM8A Antibody (NBP1-88376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM8A Antibody (NBP1-88376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM8A Products

Bioinformatics Tool for RBM8A Antibody (NBP1-88376)

Discover related pathways, diseases and genes to RBM8A Antibody (NBP1-88376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM8A Antibody (NBP1-88376)

Discover more about diseases related to RBM8A Antibody (NBP1-88376).
 

Pathways for RBM8A Antibody (NBP1-88376)

View related products by pathway.

PTMs for RBM8A Antibody (NBP1-88376)

Learn more about PTMs related to RBM8A Antibody (NBP1-88376).

Blogs on RBM8A

There are no specific blogs for RBM8A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM8A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM8A