Home » RBM8A » RBM8A Antibodies » RBM8A Antibody

RBM8A Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RBM8A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
Specificity
Specificity of human RBM8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM8A Protein (NBP1-88376PEP)
Publications
Read Publication using NBP1-88376.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23917022)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM8A Antibody

  • Binder of OVCA1-1
  • BOV-1
  • BOV-1A
  • BOV-1B
  • BOV-1C
  • MDS014
  • RBM8BRBM8
  • ribonucleoprotein RBM8
  • Ribonucleoprotein RBM8A
  • RNA binding motif protein 8A
  • RNA binding motif protein 8B
  • RNA-binding motif protein 8A
  • RNA-binding protein 8A
  • RNA-binding protein Y14
  • Y14
  • ZNRP
  • ZRNP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
46420002
ELISA: TAT Antibody [46420002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
Recombinant Human
Cyclin T1 Protein
H00000904-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
TDP-43/TARDBP
Antibody (2E2-D3)
H00023435-M01
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - TARDBP monoclonal antibody (M01), clone 2E2-D3 Analysis of TARDBP expression in A-431.
Immunocytochemistry/Immunofluorescence: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - Analysis of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue Antibody concentration 3 ug/ml.
(2 Reviews)
(147 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
TRBP Antibody
NBP2-24725
Western Blot: TRBP Antibody [NBP2-24725] - Analysis of TRBP in human brain lysate in the 1) absence, 2) presence of immunizing peptide using this antibody at 6 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using this antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using control (rabbit Ig) at 5 ug/ml.
(1 Publication)
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Mago nashi homolog
2 Antibody
H00055110-B01P
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.
Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA, ICC/IF
Cdk9 Antibody
(SD204-07)
NBP2-67811
Western Blot: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of Cdk9 on different lysates using anti-Cdk9 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: A431
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of paraffin-embedded human tonsil tissue using anti-Cdk9 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in paraffin-embedded formalin-fixed human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
FUS Antibody
NBP1-89113
Western Blot: FUS Antibody [NBP1-89113] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-FUS antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP1-89113] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FUS Antibody [NBP1-89113] - Staining in human endometrium and liver tissues. Corresponding FUS RNA-seq data are presented for the same tissues.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Progranulin/PGRN
Antibody [Unconjugate ...
AF2557
Western blot shows lysates of mouse uterus tissue and J774A.1 mouse reticulum cell sarcoma macrophage cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Progranulin/PGRN at approximately 85‑90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Progranulin was detected in immersion fixed frozen sections of mouse kidney using Sheep Anti-Mouse Progranulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(11 Publications)
Species: Mu
Applications: WB, IHC
MAGOH Antibody
NBP2-46689
Western Blot: MAGOH Antibody [NBP2-46689] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry: MAGOH Antibody [NBP2-46689] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Aly Antibody
NBP1-33598
Western Blot: Aly Antibody [NBP1-33598] - Sample (30 ug of whole cell lysate) A: Molt-4 12% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Aly Antibody [NBP1-33598] - Paraformaldehyde-fixed HeLa, using Aly (NBP1-33598) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Aly Antibody [NBP1-33598] - Human esophageal cancer ALY antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CRAT Antibody
NBP1-86614
Western Blot: CRAT Antibody [NBP1-86614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Analysis in human testis and tonsil tissues using Anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GLYAT Antibody
NBP2-55298
Western Blot: GLYAT Antibody [NBP2-55298] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining in human kidney and skeletal muscle tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
CASC3 Antibody
NBP1-30321
Immunohistochemistry: CASC3 Antibody [NBP1-30321] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CASC3 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Immunoprecipitation: CASC3 Antibody [NBP1-30321] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CASC3 used for IP at 3 mcg/mg lysate. CASC3 was also immunoprecipitated by another rabbit anti-CASC3 antibody, which recognizes a downstream epitope.
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NXF1 Antibody
NBP1-57160
Western Blot: NXF1 Antibody [NBP1-57160] - Lanes: Lane 1 : 7ug HeLa lysate +EGFP SiRNA Lane 2: 7ug HeLa lysate +NXF1 SiRNA Primary, Antibody Dilution: 1 : 300 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF1.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: NXF1 Antibody [NBP1-57160] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Species: Hu
Applications: WB, IHC, IHC-P, KD
Tau Antibody (2E9)
NBP2-25162
Western Blot: Tau Antibody (2E9) [NBP2-25162] - Analysis of different tissue lysates using mouse mAb to MAP-tau, NBP2-25162, dilution 1:2,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Tau protein is expressed as up to 9 different isoforms of different molecular weight, and so appears as multiple closely spaced bands in the range from 48 kDa to 67 kDa in the CNS and including larger big tau forms in the PNS, visible in lane 5.
Immunocytochemistry/Immunofluorescence: Tau Antibody (2E9) [NBP2-25162] - Analysis of cortical neuron-glial culture from E20 rat stained with mouse mAb to MAP-tau, NBP2-25162, dilution 1:1,000 in green, and costained with chicken pAb to MAP2, dilution 1:5,000 in red. The blue is DAPI staining of nuclear DNA. NBP2-25162 antibody stains perikarya, dendrites and axons of neurons, while MAP2 antibody labels only dendrites and perikarya. As a result, perikarya and dendrites appear orange-yellow, since they contain both proteins.
Immunocytochemistry/Immunofluorescence: Tau Antibody (2E9) [NBP2-25162] - E18 primary rat hippocampal neurons (from Neuromics) were fixed and immunostained with NBP2-25162 (green), chicken antibody to alpha Internexin (NBP1-05208, red) and for DNA (blue). NBP2-25162 stains the neuronal perikarya and processes strongly, and does not stain non neuronal cells in these cultures. The alpha Internexin antibody stains intermediate or 10nm filament bundles in the cytoplasm of these cells.
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
EIF4A3 Antibody
NBP1-85268
Western Blot: EIF4A3 Antibody [NBP1-85268] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody [NBP1-85268] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining in human testis and pancreas tissues using anti-EIF4A3 antibody. Corresponding EIF4A3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Pan PSG Antibody
(684701) [Unconjugate ...
MAB6799
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PSG Pan Specific Monoclonal Antibody (Catalog # MAB6799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PSG at approximately 72 and 64 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PSG was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human PSG Pan Specific Mono­clonal Antibody (Catalog # MAB6799) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytotrophoblast cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC

Publications for RBM8A Antibody (NBP1-88376)(1)


Reviews for RBM8A Antibody (NBP1-88376) (0)

There are no reviews for RBM8A Antibody (NBP1-88376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM8A Antibody (NBP1-88376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM8A Products

Bioinformatics Tool for RBM8A Antibody (NBP1-88376)

Discover related pathways, diseases and genes to RBM8A Antibody (NBP1-88376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM8A Antibody (NBP1-88376)

Discover more about diseases related to RBM8A Antibody (NBP1-88376).
 

Pathways for RBM8A Antibody (NBP1-88376)

View related products by pathway.

PTMs for RBM8A Antibody (NBP1-88376)

Learn more about PTMs related to RBM8A Antibody (NBP1-88376).

Blogs on RBM8A

There are no specific blogs for RBM8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM8A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM8A