RBM8A Antibody

Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in human cell line MCF-7.

Immunocytochemistry/Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells.

Western Blot: RBM8A Antibody [NBP1-88376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Western Blot: RBM8A Antibody [NBP1-88376] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RBM8A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV
• Specificity: Specificity of human RBM8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM8A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM8A Protein (NBP1-88376PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31672445).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM8A Antibody

• Binder of OVCA1-1
• BOV-1
• BOV-1A
• BOV-1B
• BOV-1C
• MDS014
• RBM8BRBM8
• ribonucleoprotein RBM8
• Ribonucleoprotein RBM8A
• RNA binding motif protein 8A
• RNA binding motif protein 8B
• RNA-binding motif protein 8A
• RNA-binding protein 8A
• RNA-binding protein Y14
• Y14
• ZNRP
• ZRNP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM8A Antibody (NBP1-88376)(2)

Publications using NBP1-88376

• Ghemrawi R, Arnold C, Battaglia-Hsu SF et al. SIRT1 activation rescues the mislocalization of RNA-binding proteins and cognitive defects induced by inherited cobalamin disorders Metab. Clin. Exp. 2019 Oct 28 [PMID: 31672445] (WB, ICC/IF, Mouse)
• Singh KK, Wachsmuth L, Kulozik AE et al. Two mammalian MAGOH genes contribute to exon junction complex composition and nonsense-mediated decay. RNA Biol 2013 Aug [PMID: 23917022]

Bioinformatics

• Gene Symbol: RBM8A