TDP-43/TARDBP Antibody (4R5L7)

Western Blot: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Western blot analysis of extracts of various cell lines, using TDP-43/TARDBP antibody (NBP3-15677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded mouse brain using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded rat ovary using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TDP-43/TARDBP Antibody (4R5L7) [NBP3-15677] - Immunohistochemistry of paraffin-embedded human esophageal using TDP-43/TARDBP Rabbit mAb (NBP3-15677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of HeLa cells using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunoprecipitation of TDP-43/TARDBP from 500 ug extracts of K-562 cells was performed using 2 ug of TDP-43/TARDBP Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using TDP-43/TARDBP Rabbit mAb at a dilution of 1:500.

Chromatin Immunoprecipitation: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Chromatin immunoprecipitation analysis of extracts of K562 cells, using TDP-43/TARDBP Rabbit mAb and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunocytochemistry/ Immunofluorescence: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Confocal imaging of paraffin-embedded Mouse brain tissue using TDP-43/TARDBP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Human colon using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TDP-43/TARDBP Antibody (4R5L7) [TDP-43/TARDBP] - Immunohistochemistry analysis of paraffin-embedded Rat liver using TDP-43/TARDBP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, ChIP
• Clone: 4R5L7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TDP-43/TARDBP Antibody (4R5L7) Summary

• Description: Novus Biologicals Rabbit TDP-43/TARDBP Antibody (4R5L7) (NBP3-15677) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148). GNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TARDBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:2000
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TDP-43/TARDBP Antibody (4R5L7)

• ALS10
• ALS10TAR DNA-binding protein-43
• TAR DNA binding protein
• TARDBP
• TDP43
• TDP-43
• TDP-43TAR DNA-binding protein 43

Background

TARDBP, also known as TAR DNA binding protein, is a DNA and RNA-binding protein which regulates transcription and splicing. TARDBP is also involved in the regulation of CFTR splicing and promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. TARD-BP may also be involved in microRNA biogenesis, apoptosis and cell division. TARDBP can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TARDBP