TBP like protein TLP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TBP like protein TLP Antibody [NBP2-57783] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBP like protein TLP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI
Specificity
Specificity of human TBP like protein TLP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBPL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBP like protein TLP Recombinant Protein Antigen (NBP2-57783PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TBP like protein TLP Antibody

  • 21 kDa TBP-like protein
  • STUD21-kDA TBP-like protein
  • TATA box binding protein-related factor 2
  • TATA box-binding protein-like protein 1
  • TATA box-binding protein-related factor 2
  • TBP-like 1
  • TBP-like factor
  • TBP-like protein 1
  • TBP-related factor 2
  • TBP-related protein
  • TLFMGC:8389
  • TLP21
  • TLPMGC:9620
  • TRF2Second TBP of unique DNA protein
  • TRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt, Ma, Ma
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB110-40763
Species: Hu, Mu, Rt, Gp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Pm
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-41262
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77262
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for TBP like protein TLP Antibody (NBP2-57783) (0)

There are no publications for TBP like protein TLP Antibody (NBP2-57783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBP like protein TLP Antibody (NBP2-57783) (0)

There are no reviews for TBP like protein TLP Antibody (NBP2-57783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBP like protein TLP Antibody (NBP2-57783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBP like protein TLP Products

Bioinformatics Tool for TBP like protein TLP Antibody (NBP2-57783)

Discover related pathways, diseases and genes to TBP like protein TLP Antibody (NBP2-57783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBP like protein TLP Antibody (NBP2-57783)

Discover more about diseases related to TBP like protein TLP Antibody (NBP2-57783).
 

Pathways for TBP like protein TLP Antibody (NBP2-57783)

View related products by pathway.

PTMs for TBP like protein TLP Antibody (NBP2-57783)

Learn more about PTMs related to TBP like protein TLP Antibody (NBP2-57783).

Blogs on TBP like protein TLP

There are no specific blogs for TBP like protein TLP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBP like protein TLP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBPL1