SUV39H2 Antibody

Images

 
Western Blot: SUV39H2 Antibody [H00079723-B01P] - Analysis of SUV39H2 expression in transfected 293T cell line by SUV39H2 polyclonal antibody. Lane 1: SUV39H2 transfected lysate(38.5 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SUV39H2 Antibody Summary

Immunogen
SUV39H2 (NP_078946.1, 1 a.a. - 350 a.a.) full-length human protein. MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Specificity
SUV39H2 - suppressor of variegation 3-9 homolog 2 (Drosophila),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SUV39H2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUV39H2 Antibody

  • FLJ23414Histone H3-K9 methyltransferase 2
  • H3-K9-HMTase 2
  • histone-lysine N-methyltransferase SUV39H2
  • KMT1BEC 2.1.1.43
  • Lysine N-methyltransferase 1B
  • Su(var)3-9 homolog 2
  • suppressor of variegation 3-9 homolog 2 (Drosophila)
  • Suppressor of variegation 3-9 homolog 2

Background

Suppressor of variegation 3-9 homolog 2 (Drosophila) is a histone lysine N-methyltransferase activity (H3-K9 specific). This protein contains a SET domain (HMTase activity) and binds chromatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUV39H2 Antibody (H00079723-B01P) (0)

There are no publications for SUV39H2 Antibody (H00079723-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUV39H2 Antibody (H00079723-B01P) (0)

There are no reviews for SUV39H2 Antibody (H00079723-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUV39H2 Antibody (H00079723-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUV39H2 Products

Research Areas for SUV39H2 Antibody (H00079723-B01P)

Find related products by research area.

Blogs on SUV39H2

There are no specific blogs for SUV39H2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUV39H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUV39H2
Entrez
Uniprot