SUV39H2 Antibody Summary
Immunogen |
SUV39H2 (NP_078946.1, 1 a.a. - 350 a.a.) full-length human protein. MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN |
Specificity |
SUV39H2 - suppressor of variegation 3-9 homolog 2 (Drosophila), |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
SUV39H2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SUV39H2 Antibody
Background
Suppressor of variegation 3-9 homolog 2 (Drosophila) is a histone lysine N-methyltransferase activity (H3-K9 specific). This protein contains a SET domain (HMTase activity) and binds chromatin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IP, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: WB
Publications for SUV39H2 Antibody (H00079723-B01P) (0)
There are no publications for SUV39H2 Antibody (H00079723-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SUV39H2 Antibody (H00079723-B01P) (0)
There are no reviews for SUV39H2 Antibody (H00079723-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SUV39H2 Antibody (H00079723-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SUV39H2 Products
Bioinformatics Tool for SUV39H2 Antibody (H00079723-B01P)
Discover related pathways, diseases and genes to SUV39H2 Antibody (H00079723-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SUV39H2 Antibody (H00079723-B01P)
Discover more about diseases related to SUV39H2 Antibody (H00079723-B01P).
| | Pathways for SUV39H2 Antibody (H00079723-B01P)
View related products by pathway.
|
PTMs for SUV39H2 Antibody (H00079723-B01P)
Learn more about PTMs related to SUV39H2 Antibody (H00079723-B01P).
| | Research Areas for SUV39H2 Antibody (H00079723-B01P)
Find related products by research area.
|
Blogs on SUV39H2