| Immunogen | Synthetic peptides corresponding to TMEM173(transmembrane protein 173) The peptide sequence was selected from the middle region of TMEM173.
Peptide sequence DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STING1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against TMEM173 and was validated on Western blot. |
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for STING/TMEM173 Antibody (NBP1-54600)Find related products by research area.
|
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.