TSPAN6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TSPAN6 Antibody [NBP1-86976] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: TSPAN6 Antibody [NBP1-86976] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSPAN6 Protein (NBP1-86976PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPAN6 Antibody

  • Putative NF-kappa-B-activating protein 321
  • T245 protein
  • T245
  • tetraspanin 6
  • Tetraspanin TM4-D
  • tetraspanin-6
  • TM4-D
  • TM4SF6
  • TM4SF6tetraspan TM4SF
  • Transmembrane 4 superfamily member 6A15 homolog
  • TSPAN6
  • TSPAN-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-24683
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ICC, IF
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89939
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC

Publications for TSPAN6 Antibody (NBP1-86976) (0)

There are no publications for TSPAN6 Antibody (NBP1-86976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN6 Antibody (NBP1-86976) (0)

There are no reviews for TSPAN6 Antibody (NBP1-86976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TSPAN6 Antibody (NBP1-86976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPAN6 Products

Bioinformatics Tool for TSPAN6 Antibody (NBP1-86976)

Discover related pathways, diseases and genes to TSPAN6 Antibody (NBP1-86976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN6 Antibody (NBP1-86976)

Discover more about diseases related to TSPAN6 Antibody (NBP1-86976).
 

Pathways for TSPAN6 Antibody (NBP1-86976)

View related products by pathway.

PTMs for TSPAN6 Antibody (NBP1-86976)

Learn more about PTMs related to TSPAN6 Antibody (NBP1-86976).
 

Research Areas for TSPAN6 Antibody (NBP1-86976)

Find related products by research area.

Blogs on TSPAN6

There are no specific blogs for TSPAN6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN6
Entrez