TSPAN6 Antibody

Immunohistochemistry-Paraffin: TSPAN6 Antibody [NBP1-86976] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TSPAN6 Antibody [NBP1-86976] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TSPAN6 Antibody [NBP1-86976] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TSPAN6 Antibody [NBP1-86976] - Staining of human skeletal muscle shows negative membranous positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TSPAN6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSPAN6 Antibody

• Putative NF-kappa-B-activating protein 321
• T245 protein
• T245
• tetraspanin 6
• Tetraspanin TM4-D
• tetraspanin-6
• TM4-D
• TM4SF6
• TM4SF6tetraspan TM4SF
• Transmembrane 4 superfamily member 6A15 homolog
• TSPAN6
• TSPAN-6

Background

The protein encoded by the Tetraspanin-6 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The use of alternate polyadenylation sites has been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPAN6