CISD2 Antibody


Western Blot: CISD2 Antibody [NBP1-84809] - Analysis in control (vector only transfected HEK293T lysate) and CISD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CISD2 Antibody [NBP1-84809] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CISD2 Antibody [NBP1-84809] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

CISD2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Predicted Species
Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CISD2 Protein (NBP1-84809PEP)
Read Publication using NBP1-84809.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CISD2 Antibody

  • CDGSH iron sulfur domain 2
  • CDGSH iron-sulfur domain-containing protein 2
  • CDGSH2
  • Endoplasmic reticulum intermembrane small protein
  • Miner1Wolfram syndrome 2
  • mitoNEET related 1
  • MitoNEET-related 1 protein
  • NAF-1
  • Nutrient-deprivation autophagy factor-1
  • ZCD2CDGSH iron sulfur domain-containing protein 2
  • zinc finger, CDGSH-type domain 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CISD2 Antibody (NBP1-84809)(1)

Reviews for CISD2 Antibody (NBP1-84809) (0)

There are no reviews for CISD2 Antibody (NBP1-84809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CISD2 Antibody (NBP1-84809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CISD2 Products

Array NBP1-84809

Research Areas for CISD2 Antibody (NBP1-84809)

Find related products by research area.

Blogs on CISD2

There are no specific blogs for CISD2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CISD2 Antibody and receive a gift card or discount.


Gene Symbol CISD2