STAT3 Antibody - BSA Free

Western Blot: STAT3 Antibody [NBP2-38857] - Analysis in human cell lines A-549 and PC-3 using anti-STAT3 antibody. Corresponding STAT3 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunohistochemistry-Paraffin: STAT3 Antibody [NBP2-38857] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: STAT3 Antibody [NBP2-38857] - Staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: STAT3 Antibody [NBP2-38857] - Staining of human fallopian tube shows moderate cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: STAT3 Antibody [NBP2-38857] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: STAT3 Antibody [NBP2-38857] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

ChIP-Exo-Seq composite graph for Anti-STAT3 (NBP2-38857) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STAT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STAT3 Antibody - BSA Free (NBP2-38857) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAT3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STAT3 Protein (NBP2-38857PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STAT3 Antibody - BSA Free

• Acute-phase response factor
• APRFMGC16063
• DNA-binding protein APRF
• FLJ20882
• HIES
• signal transducer and activator of transcription 3 (acute-phase responsefactor)
• signal transducer and activator of transcription 3
• STAT3

Background

Stat3 is a member of a group of proteins (Signal Transduction and Activators of Transcription) that act as both signal transducers for cytokines and growth factors, as well as transcription factors (1,2). Stats are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus (1). Stat3 is constitutively activated in a number of human tumors (3). Stat3 is activated by phosphorylation on tyrosine 705 which induces dimerization, nuclear translocation, and DNA binding While, Stat3-activated transcription seems to be regulated by serine phosphorylation at serine 727 (4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAT3
• Uniprot:
  • P40763()