ST3GAL4 Antibody


Western Blot: ST3GAL4 Antibody [NBP1-69565] - This Anti-ST3GAL4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.
Immunohistochemistry: ST3GAL4 Antibody [NBP1-69565] - Human Liver cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ST3GAL4 Antibody Summary

Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-69565 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for ST3GAL4 Antibody

  • Alpha 2,3-sialyltransferase IV
  • Alpha 2,3-ST 4
  • Beta-galactoside alpha-2,3-sialyltransferase 4
  • CGS23
  • CGS23FLJ46764
  • EC 2.4.99
  • EC 2.4.99.-
  • EC
  • FLJ11867
  • gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase
  • Gal-NAc 6S
  • gal-NAc6S
  • NANTA3
  • NANTA3alpha-3-N-acetylneuraminyltransferase
  • SAT3
  • SAT-3
  • sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
  • sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
  • Sialyltransferase 4C
  • SIAT4
  • SIAT4C
  • SIAT4-C
  • SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 4
  • ST3Gal IV
  • ST3GAL4
  • ST3GalA.2
  • ST3GalIV
  • ST-4


Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC, including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Gp
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ST3GAL4 Antibody (NBP1-69565)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ST3GAL4 Antibody (NBP1-69565) (0)

There are no reviews for ST3GAL4 Antibody (NBP1-69565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3GAL4 Antibody (NBP1-69565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ST3GAL4 Products

Bioinformatics Tool for ST3GAL4 Antibody (NBP1-69565)

Discover related pathways, diseases and genes to ST3GAL4 Antibody (NBP1-69565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL4 Antibody (NBP1-69565)

Discover more about diseases related to ST3GAL4 Antibody (NBP1-69565).

Pathways for ST3GAL4 Antibody (NBP1-69565)

View related products by pathway.

PTMs for ST3GAL4 Antibody (NBP1-69565)

Learn more about PTMs related to ST3GAL4 Antibody (NBP1-69565).

Blogs on ST3GAL4

There are no specific blogs for ST3GAL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ST3GAL4 Antibody and receive a gift card or discount.


Gene Symbol ST3GAL4
COVID-19 update