SOX17 Antibody - BSA Free

Immunohistochemistry-Paraffin: SOX17 Antibody [NBP2-49549] - analysis in human fallopian tube and pancreas tissues. Corresponding SOX17 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SOX17 Antibody [NBP2-49549] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: SOX17 Antibody [NBP2-49549] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: SOX17 Antibody [NBP2-49549] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SOX17 Antibody [NBP2-49549] - Staining of human endometrium shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-SOX17 (NBP2-49549) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOX17 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOX17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SOX17 Recombinant Protein Antigen (NBP2-49549PEP)

Reactivity Notes

Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SOX17 Antibody - BSA Free

• FLJ22252
• SOX17
• SRY (sex determining region Y)-box 17
• SRY-related HMG-box transcription factor SOX17
• transcription factor SOX-17
• VUR3

Background

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulationof embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptionalregulator after formi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX17