Orthogonal Strategies: Analysis in human cerebral cortex and lymph node tissues using NBP1-89745 antibody. Corresponding SORT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Orthogonal Strategies: Analysis in human cell lines SK-MEL-30 and PC-3 using Anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Sortilin Antibody - BSA Free
100 kDa NT receptor
Glycoprotein 95
Gp95
Gp95LDLCQ6
Neurotensin receptor 3
NT3NTR3
Ntr3
SORT1
sortilin 1
Sortilin
Background
Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Sortilin Antibody (NBP1-89745). (Showing 1 - 2 of 2 FAQ).
NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
HIER= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.
NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
hier= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Sortilin Antibody - BSA Free and receive a gift card or discount.