Sortilin Antibody - BSA Free

Western Blot: Sortilin Antibody [NBP1-89745] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining in human cerebral cortex and lymph node tissues using NBP1-89745 antibody. Corresponding SORT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sortilin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SORT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sortilin Protein (NBP1-89745PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sortilin Antibody - BSA Free

• 100 kDa NT receptor
• Glycoprotein 95
• Gp95
• Gp95LDLCQ6
• Neurotensin receptor 3
• NT3NTR3
• Ntr3
• SORT1
• sortilin 1
• Sortilin

Background

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sortilin Antibody (NBP1-89745)(1)

Publication using NBP1-89745

• Qiu S, Nikolaou S, Zhu J et al. Characterisation of the Expression of Neurotensinand Its Receptors in Human Colorectal Cancer and ItsClinical Implications Biomolecules 2020-08-05 [PMID: 32764278] (IHC-P, Human)

FAQs for Sortilin Antibody (NBP1-89745). (Showing 1 - 2 of 2 FAQ).

1. NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
   • HIER= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.
2. NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
   • hier= heat induced epitope retrieval. Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

Bioinformatics

• Gene Symbol: SORT1