Neurotensin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Analysis in human small intestine and skeletal muscle tissues. Corresponding NTS RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human small intestine shows strong cytoplasmic positivity in endocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neurotensin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neurotensin Protein (NBP2-33903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurotensin Antibody

  • Neurotensin
  • neurotensin/neuromedin N
  • NMN-125
  • NN
  • NT
  • NT/N
  • NTS
  • NTS1

Background

Neurotensin, also known as neurotensin/neuromedin N and NTS, is a member of the neurotensin family. Neurotensin is the precursor to the neuromedin N and neurotensin peptides. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. Neurotensin is also involved in the endocrine and paracrine regulation of fat metabolism and smooth muscle contraction. Due to these involvements, neurotensin has been linked to dopamine-associated pathophysiological events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P

Publications for Neurotensin Antibody (NBP2-33903) (0)

There are no publications for Neurotensin Antibody (NBP2-33903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotensin Antibody (NBP2-33903) (0)

There are no reviews for Neurotensin Antibody (NBP2-33903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurotensin Antibody (NBP2-33903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurotensin Products

Bioinformatics Tool for Neurotensin Antibody (NBP2-33903)

Discover related pathways, diseases and genes to Neurotensin Antibody (NBP2-33903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotensin Antibody (NBP2-33903)

Discover more about diseases related to Neurotensin Antibody (NBP2-33903).
 

Pathways for Neurotensin Antibody (NBP2-33903)

View related products by pathway.

PTMs for Neurotensin Antibody (NBP2-33903)

Learn more about PTMs related to Neurotensin Antibody (NBP2-33903).
 

Research Areas for Neurotensin Antibody (NBP2-33903)

Find related products by research area.

Blogs on Neurotensin

There are no specific blogs for Neurotensin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurotensin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTS
Uniprot