Neurotensin Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining in human small intestine and liver tissues using anti-NTS antibody. Corresponding NTS RNA-seq data are presented more
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human small intestine shows distinct positivity in subsets of cells.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Neurotensin Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP
Specificity of human Neurotensin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neurotensin Protein (NBP2-33903PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Neurotensin Antibody

  • neurotensin
  • neurotensin/neuromedin N
  • NMN-125
  • NN
  • NT
  • NT/N
  • NTS1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA

Publications for Neurotensin Antibody (NBP2-33903) (0)

There are no publications for Neurotensin Antibody (NBP2-33903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotensin Antibody (NBP2-33903) (0)

There are no reviews for Neurotensin Antibody (NBP2-33903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurotensin Antibody (NBP2-33903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Neurotensin Antibody (NBP2-33903)

Discover related pathways, diseases and genes to Neurotensin Antibody (NBP2-33903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotensin Antibody (NBP2-33903)

Discover more about diseases related to Neurotensin Antibody (NBP2-33903).

Pathways for Neurotensin Antibody (NBP2-33903)

View related products by pathway.

PTMs for Neurotensin Antibody (NBP2-33903)

Learn more about PTMs related to Neurotensin Antibody (NBP2-33903).

Research Areas for Neurotensin Antibody (NBP2-33903)

Find related products by research area.

Blogs on Neurotensin

There are no specific blogs for Neurotensin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Neurotensin Antibody and receive a gift card or discount.


Gene Symbol NTS