SMC2 Antibody - BSA Free

Western Blot: SMC2 Antibody [NBP1-52932] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SMC2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SMC2 Antibody - BSA Free

• CAP-E
• CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast)
• Chromosome-associated protein E
• FLJ10093
• hCAP-EXCAP-E homolog
• SMC protein 2
• SMC2 (structural maintenance of chromosomes 2, yeast)-like 1
• SMC2 structural maintenance of chromosomes 2-like 1
• SMC-2
• SMC2L1
• structural maintenance of chromosomes (SMC) family member
• structural maintenance of chromosomes 2
• structural maintenance of chromosomes protein 2

Background

SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMC2