SMC4 Antibody

Western Blot: SMC4 Antibody [NBP1-86635] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: SMC4 Antibody [NBP1-86635] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMC4 Antibody [NBP1-86635] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in tubule cells.

Western Blot: SMC4 Antibody [NBP1-86635] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-544

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMC4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF reported in scientific literature (PMID: 28302748). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMC4 Protein (NBP1-86635PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMC4 Antibody

• CAP-C
• CAPCSMC4 structural maintenance of chromosomes 4-like 1 (yeast)
• Chromosome-associated polypeptide C
• hCAP-CSMC4 (structural maintenance of chromosomes 4, yeast)-like 1
• SMC protein 4
• SMC4 structural maintenance of chromosomes 4-like 1
• SMC-4
• SMC4L1
• structural maintenance of chromosomes 4
• structural maintenance of chromosomes protein 4
• XCAP-C homolog

Background

Structural Maintenance of Chromosome (SMC) proteins are required for nuclear processes, including chromosome condensation, chromatid cohesion, and DNA repair. Eukaryotic proteins are capable of binding DNA and possess a DNA-stimulated ATPase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMC4 Antibody (NBP1-86635)(4)

Publications using NBP1-86635

• Lee C, Leem J, Oh JS Selective utilization of non-homologous end-joining and homologous recombination for DNA repair during meiotic maturation in mouse oocytes Cell proliferation 2022-12-23 [PMID: 36564861] (ICC/IF, Mouse)
  
  Details:
  Dilution used in ICC 1:100
• Hwang G, Sun F, O'Brien M et al. SMC5/6 is required for the formation of segregation-competent bivalent chromosomes during meiosis I in mouse oocytes. Development. 2017-03-16 [PMID: 28302748] (ICC/IF, Mouse)
• Flashner S, Swift M, Sowash A, Azizkhan-Clifford J Transcription factor Sp1 regulates mitotic fidelity through Aurora B kinase-mediated condensin I localization bioRxiv 2020-06-20 (ICC/IF, Human)
• Flashner S, Swift M, Sowash A et al. Transcription factor Sp1 regulates mitotic chromosome assembly and segregation Chromosoma 2022-08-02 [PMID: 35916925] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: SMC4