SMC4 Antibody

Images

 
Western Blot: SMC4 Antibody [NBP1-86635] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SMC4 Antibody [NBP1-86635] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SMC4 Antibody [NBP1-86635] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in tubule cells.
Western Blot: SMC4 Antibody [NBP1-86635] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-544

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 28302748). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMC4 Protein (NBP1-86635PEP)
Publications
Read Publications using
NBP1-86635 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMC4 Antibody

  • CAP-C
  • CAPCSMC4 structural maintenance of chromosomes 4-like 1 (yeast)
  • Chromosome-associated polypeptide C
  • hCAP-CSMC4 (structural maintenance of chromosomes 4, yeast)-like 1
  • SMC protein 4
  • SMC4 structural maintenance of chromosomes 4-like 1
  • SMC-4
  • SMC4L1
  • structural maintenance of chromosomes 4
  • structural maintenance of chromosomes protein 4
  • XCAP-C homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-373
Species: Hu
Applications: ICC/IF, IP, KD, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-85922
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-88345
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
H00009918-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-20420
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67446
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-47271
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-25966
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1573
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-516
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB

Publications for SMC4 Antibody (NBP1-86635)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-86635 Applications Species
Hwang G, Sun F, O'Brien M et al. SMC5/6 is required for the formation of segregation-competent bivalent chromosomes during meiosis I in mouse oocytes. Development. Mar 16 2017 [PMID: 28302748] (ICC/IF, Mouse) ICC/IF Mouse
Flashner S, Swift M, Sowash A, Azizkhan-Clifford J Transcription factor Sp1 regulates mitotic fidelity through Aurora B kinase-mediated condensin I localization bioRxiv Jun 20 2020 (ICC/IF, Human) ICC/IF Human

Reviews for SMC4 Antibody (NBP1-86635) (0)

There are no reviews for SMC4 Antibody (NBP1-86635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMC4 Antibody (NBP1-86635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMC4 Products

Bioinformatics Tool for SMC4 Antibody (NBP1-86635)

Discover related pathways, diseases and genes to SMC4 Antibody (NBP1-86635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC4 Antibody (NBP1-86635)

Discover more about diseases related to SMC4 Antibody (NBP1-86635).
 

Pathways for SMC4 Antibody (NBP1-86635)

View related products by pathway.

PTMs for SMC4 Antibody (NBP1-86635)

Learn more about PTMs related to SMC4 Antibody (NBP1-86635).
 

Research Areas for SMC4 Antibody (NBP1-86635)

Find related products by research area.

Blogs on SMC4

There are no specific blogs for SMC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC4