Smad5 Antibody


Western Blot: Smad5 Antibody [NBP2-32406] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Smad5 Antibody [NBP2-32406] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Smad5 Antibody [NBP2-32406] - Staining of human uterus, post-menopause shows strong membranous positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Smad5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Smad5 Protein (NBP2-32406PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Smad5 Antibody

  • Dwfc
  • hSmad5
  • JV5-1
  • JV5-1DKFZp781O1323
  • MAD homolog 5
  • MAD, mothers against decapentaplegic homolog 5 (Drosophila)
  • MADH5
  • MADH5mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic, drosophila, homolog of, 5
  • Mothers against DPP homolog 5
  • SMA- and MAD-related protein 5
  • SMAD 5
  • SMAD family member 5DKFZp781C1895
  • SMAD, mothers against DPP homolog 5 (Drosophila)
  • SMAD, mothers against DPP homolog 5
  • Smad5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Smad5 Antibody (NBP2-32406) (0)

There are no publications for Smad5 Antibody (NBP2-32406).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad5 Antibody (NBP2-32406) (0)

There are no reviews for Smad5 Antibody (NBP2-32406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Smad5 Antibody (NBP2-32406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Smad5 Products

Bioinformatics Tool for Smad5 Antibody (NBP2-32406)

Discover related pathways, diseases and genes to Smad5 Antibody (NBP2-32406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad5 Antibody (NBP2-32406)

Discover more about diseases related to Smad5 Antibody (NBP2-32406).

Pathways for Smad5 Antibody (NBP2-32406)

View related products by pathway.

PTMs for Smad5 Antibody (NBP2-32406)

Learn more about PTMs related to Smad5 Antibody (NBP2-32406).

Research Areas for Smad5 Antibody (NBP2-32406)

Find related products by research area.

Blogs on Smad5

There are no specific blogs for Smad5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Smad5 Antibody and receive a gift card or discount.


Gene Symbol SMAD5