Sirtuin 5/SIRT5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human Stomach shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human heart muscle shows moderate to strong granular cytoplasmic positivity.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Analysis in human heart muscle and pancreas tissues using NBP1-86013 antibody. Corresponding SIRT5 RNA-seq data are presented for the same tissues.

Analysis in control (vector only transfected HEK293T lysate) and SIRT5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sirtuin 5/SIRT5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRT5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26658802). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sirtuin 5/SIRT5 Protein (NBP1-86013PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26658802).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sirtuin 5/SIRT5 Antibody - BSA Free

• EC 3.5.1
• EC 3.5.1.-
• FLJ36950
• NAD-dependent deacetylase sirtuin-5
• silent mating type information regulation 2, S.cerevisiae, homolog 5
• SIR2L5
• sir2-like 5
• SIR2-like protein 5
• SIRT5
• sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5
• Sirtuin 5
• sirtuin type 5

Background

SIRT5 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sirtuin 5/SIRT5 Antibody (NBP1-86013)(1)

Publication using NBP1-86013

• Lv XB, Liu L, Cheng C et al. SUN2 exerts tumor suppressor functions by suppressing the Warburg effect in lung cancer. Sci Rep 2015-12-10 [PMID: 26658802] (WB, Human)

Bioinformatics

• Gene Symbol: SIRT5