Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human Stomach shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human heart muscle shows moderate to strong granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Analysis in human heart muscle and pancreas tissues using NBP1-86013 antibody. Corresponding SIRT5 RNA-seq data are presented for the same tissues.
Analysis in control (vector only transfected HEK293T lysate) and SIRT5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Novus Biologicals Rabbit Sirtuin 5/SIRT5 Antibody - BSA Free (NBP1-86013) is a polyclonal antibody validated for use in IHC and WB. Anti-Sirtuin 5/SIRT5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRT5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Human reactivity reported in scientific literature (PMID: 26658802).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Sirtuin 5/SIRT5 Antibody - BSA Free
EC 3.5.1
EC 3.5.1.-
FLJ36950
NAD-dependent deacetylase sirtuin-5
silent mating type information regulation 2, S.cerevisiae, homolog 5
SIR2L5
sir2-like 5
SIR2-like protein 5
SIRT5
sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5
Sirtuin 5
sirtuin type 5
Background
SIRT5 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86013) (0)
There are no reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86013).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Sirtuin 5/SIRT5 Antibody - BSA Free and receive a gift card or discount.