Sirtuin 5/SIRT5 Antibody


Western Blot: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining in human heart muscle and pancreas tissues. Corresponding SIRT5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human adrenal gland shows strong granular staining of the cytoplasm in cortical cells.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human heart muscle shows moderate to strong granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Sirtuin 5/SIRT5 Antibody [NBP1-86013] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Sirtuin 5/SIRT5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL
Specificity of human Sirtuin 5/SIRT5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Sirtuin 5/SIRT5 Lysate (NBP2-66127)
Control Peptide
Sirtuin 5/SIRT5 Protein (NBP1-86013PEP)
Read Publication using
NBP1-86013 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26658802).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Sirtuin 5/SIRT5 Antibody

  • EC 3.5.1
  • EC 3.5.1.-
  • FLJ36950
  • NAD-dependent deacetylase sirtuin-5
  • silent mating type information regulation 2, S.cerevisiae, homolog 5
  • SIR2L5
  • sir2-like 5
  • SIR2-like protein 5
  • SIRT5
  • sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5
  • Sirtuin 5
  • sirtuin type 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Sirtuin 5/SIRT5 Antibody (NBP1-86013)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86013) (0)

There are no reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sirtuin 5/SIRT5 Antibody (NBP1-86013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Sirtuin 5/SIRT5 Products

Bioinformatics Tool for Sirtuin 5/SIRT5 Antibody (NBP1-86013)

Discover related pathways, diseases and genes to Sirtuin 5/SIRT5 Antibody (NBP1-86013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sirtuin 5/SIRT5 Antibody (NBP1-86013)

Discover more about diseases related to Sirtuin 5/SIRT5 Antibody (NBP1-86013).

Pathways for Sirtuin 5/SIRT5 Antibody (NBP1-86013)

View related products by pathway.

PTMs for Sirtuin 5/SIRT5 Antibody (NBP1-86013)

Learn more about PTMs related to Sirtuin 5/SIRT5 Antibody (NBP1-86013).

Research Areas for Sirtuin 5/SIRT5 Antibody (NBP1-86013)

Find related products by research area.

Blogs on Sirtuin 5/SIRT5

There are no specific blogs for Sirtuin 5/SIRT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sirtuin 5/SIRT5 Antibody and receive a gift card or discount.


Gene Symbol SIRT5