UCP5 Antibody

Images

 
Western Blot: UCP5 Antibody [NBP1-59598] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCP5 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC25A14(solute carrier family 25 (mitochondrial carrier, brain), member 14) The peptide sequence was selected from the N terminal of SLC25A14 (CAI42439). Peptide sequence SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunocytochemistry/Immunofluorescence
Application Notes
Use in Immunocytochemistry/Immunofluorescence, IHC reported in scientific literature (PMID:31907603).
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59598 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:31907603).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UCP5 Antibody

  • BMCP-1
  • BMCP1UCP 5
  • brain mitochondrial carrier protein 1
  • Mitochondrial uncoupling protein 5
  • solute carrier family 25 (mitochondrial carrier, brain), member 14
  • Solute carrier family 25 member 14
  • UCP5MGC149543

Background

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, PEP-ELISA
NBP2-94703
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1195
Species: All-Multi
Applications: WB, Simple Western, IHC, ICC
NBP1-51641
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NBP2-45626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for UCP5 Antibody (NBP1-59598)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-59598 Applications Species
Ko J ALTERNATIVE POLYADENYLATION MODULATES EXPRESSION OF PRO-FIBROTIC PROTEINS AND CONTRIBUTES TO LUNG FIBROSIS Thesis Jan 1 2020 (WB, Human) WB Human
Ferrer I, Andres-Benito P, Zelaya Mv et Al. Familial globular glial tauopathy linked to MAPT mutations: molecular neuropathology and seeding capacity of a prototypical mixed neuronal and glial tauopathy Acta Neuropathol. Apr 1 2020 [PMID: 31907603] (ICC/IF, IHC, Human, Mouse) ICC/IF, IHC Human, Mouse

Reviews for UCP5 Antibody (NBP1-59598) (0)

There are no reviews for UCP5 Antibody (NBP1-59598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UCP5 Antibody (NBP1-59598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UCP5 Products

Bioinformatics Tool for UCP5 Antibody (NBP1-59598)

Discover related pathways, diseases and genes to UCP5 Antibody (NBP1-59598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP5 Antibody (NBP1-59598)

Discover more about diseases related to UCP5 Antibody (NBP1-59598).
 

Pathways for UCP5 Antibody (NBP1-59598)

View related products by pathway.

PTMs for UCP5 Antibody (NBP1-59598)

Learn more about PTMs related to UCP5 Antibody (NBP1-59598).

Blogs on UCP5

There are no specific blogs for UCP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A14
Entrez
Uniprot