Peroxiredoxin 2 Antibody (4E1.0-2D2)

Images

 
Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Analysis of PRDX2 expression in Hela.
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. ...read more
Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.Lane 1: PRDX2 transfected lysate(21.9 ...read more
ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4E1.0-2D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Peroxiredoxin 2 Antibody (4E1.0-2D2) Summary

Immunogen
PRDX2 (AAH00452, 1 a.a. - 198 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Localization
Cytoplasmic
Specificity
PRDX2 - peroxiredoxin 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRDX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Positive Control
Peroxiredoxin 2 Lysate (NBP2-65731)
Reviewed Applications
Read 1 Review rated 5
using
H00007001-M01 in the following applications:

Publications
Read Publications using H00007001-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peroxiredoxin 2 Antibody (4E1.0-2D2)

  • EC 1.11.1
  • MGC4104
  • Natural killer cell-enhancing factor B
  • natural killer-enhancing factor B
  • NKEF-B
  • NKEFBNKEF-B
  • Peroxiredoxin 2
  • peroxiredoxin-2
  • PRDX2
  • PRPTDPX1
  • PRX2
  • PRXII
  • TDPX1
  • thiol-specific antioxidant 1
  • Thiol-specific antioxidant protein
  • Thioredoxin peroxidase 1
  • Thioredoxin-dependent peroxide reductase 1
  • torin
  • TPX1
  • TSA
  • TSAEC 1.11.1.15

Background

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-30465
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
AF835
Species: Hu, Mu
Applications: ICC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Peroxiredoxin 2 Antibody (H00007001-M01)(4)

Review for Peroxiredoxin 2 Antibody (H00007001-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007001-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Peroxiredoxin 2 H00007001-M01
Enlarge
reviewed by:
Corey.
WB Human 09/26/2013
View

Summary

ApplicationWestern Blot
Sample TestedHuman HeLa cell lysate
SpeciesHuman

Blocking

Blocking Details5% NFDM

Primary Anitbody

Dilution Ratio1:1000, 4C O/N

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peroxiredoxin 2 Antibody (H00007001-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Peroxiredoxin 2 Antibody (H00007001-M01)

Discover related pathways, diseases and genes to Peroxiredoxin 2 Antibody (H00007001-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 2 Antibody (H00007001-M01)

Discover more about diseases related to Peroxiredoxin 2 Antibody (H00007001-M01).
 

Pathways for Peroxiredoxin 2 Antibody (H00007001-M01)

View related products by pathway.

PTMs for Peroxiredoxin 2 Antibody (H00007001-M01)

Learn more about PTMs related to Peroxiredoxin 2 Antibody (H00007001-M01).
 

Research Areas for Peroxiredoxin 2 Antibody (H00007001-M01)

Find related products by research area.

Blogs on Peroxiredoxin 2

There are no specific blogs for Peroxiredoxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Corey.
09/26/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol PRDX2
Entrez
OMIM
Uniprot