CPS1 Antibody

Images

 
Western Blot: CPS1 Antibody [NBP1-86019] - Analysis in human liver tissue.
Immunocytochemistry/ Immunofluorescence: CPS1 Antibody [NBP1-86019] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: CPS1 Antibody [NBP1-86019] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Ca, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPS1 Protein (NBP1-86019PEP)
Publications
Read Publication using
NBP1-86019 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 24945279).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPS1 Antibody

  • carbamoyl-phosphate synthase [ammonia], mitochondrial
  • carbamoyl-phosphate synthase 1, mitochondrial
  • carbamoyl-phosphate synthetase 1, mitochondrial
  • carbamoylphosphate synthetase I
  • Carbamoyl-phosphate synthetase I
  • CPSase I
  • CPSASE1
  • EC 6.3.4.16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-58283
Species: Hu
Applications: ICC/IF
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP1-54974
Species: Hu
Applications: WB
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for CPS1 Antibody (NBP1-86019)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Canine
(1)
All Species

Reviews for CPS1 Antibody (NBP1-86019) (0)

There are no reviews for CPS1 Antibody (NBP1-86019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPS1 Antibody (NBP1-86019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPS1 Products

Bioinformatics Tool for CPS1 Antibody (NBP1-86019)

Discover related pathways, diseases and genes to CPS1 Antibody (NBP1-86019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPS1 Antibody (NBP1-86019)

Discover more about diseases related to CPS1 Antibody (NBP1-86019).
 

Pathways for CPS1 Antibody (NBP1-86019)

View related products by pathway.

PTMs for CPS1 Antibody (NBP1-86019)

Learn more about PTMs related to CPS1 Antibody (NBP1-86019).

Blogs on CPS1

There are no specific blogs for CPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPS1