Sirtuin 5/SIRT5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Sirtuin 5/SIRT5 Antibody - BSA Free (NBP1-86004) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SIRT5 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Sirtuin 5/SIRT5 Antibody - BSA Free
Background
SIRT5 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for Sirtuin 5/SIRT5 Antibody (NBP1-86004) (0)
There are no publications for Sirtuin 5/SIRT5 Antibody (NBP1-86004).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86004) (0)
There are no reviews for Sirtuin 5/SIRT5 Antibody (NBP1-86004).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sirtuin 5/SIRT5 Antibody (NBP1-86004) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sirtuin 5/SIRT5 Products
Research Areas for Sirtuin 5/SIRT5 Antibody (NBP1-86004)
Find related products by research area.
|
Blogs on Sirtuin 5/SIRT5