SHP/NR0B2/Nuclear Receptor SHP Antibody

Images

 
Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52816] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHP/NR0B2/Nuclear Receptor SHP Antibody Summary

Immunogen
Synthetic peptides corresponding to NR0B2(nuclear receptor subfamily 0, group B, member 2) The peptide sequence was selected from the N terminal of NR0B2. Peptide sequence STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR0B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NR0B2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SHP/NR0B2/Nuclear Receptor SHP Antibody

  • FLJ17090
  • NR0B2
  • nuclear receptor subfamily 0 group B member 2
  • nuclear receptor subfamily 0, group B, member 2
  • Orphan nuclear receptor SHP
  • SHP
  • SHPSHP1
  • Small heterodimer partner

Background

NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB9120
Species: Hu
Applications: ICC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-80533
Species: Mu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-52816
Species: Hu
Applications: WB

Publications for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816) (0)

There are no publications for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816) (0)

There are no reviews for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHP/NR0B2/Nuclear Receptor SHP Products

Bioinformatics Tool for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816)

Discover related pathways, diseases and genes to SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816)

Discover more about diseases related to SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816).
 

Pathways for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816)

View related products by pathway.

PTMs for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816)

Learn more about PTMs related to SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816).
 

Research Areas for SHP/NR0B2/Nuclear Receptor SHP Antibody (NBP1-52816)

Find related products by research area.

Blogs on SHP/NR0B2/Nuclear Receptor SHP

There are no specific blogs for SHP/NR0B2/Nuclear Receptor SHP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHP/NR0B2/Nuclear Receptor SHP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR0B2
Entrez
Uniprot