Reactivity | Hu, Mu, Bv, Ca, GpSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Guinea Pig (93%), Bovine (93%), Canine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | G6PC |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-80533 | Applications | Species |
---|---|---|
Chen S, Henderson A, Petriello M et al. Trimethylamine N-Oxide Binds and Activates PERK to Promote Metabolic Dysfunction Cell Metab. Sep 17 2019 [PMID: 31543404] | ||
Marquart TJ, Allen RM, Chen MR, Dorn GW Statins Stimulate Hepatic Glucose Production via the miR-183/96/182 Cluster bioRxiv Aug 7 2019 (WB, Mouse) | WB | Mouse |
Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat Med 2014 Nov [PMID: 25282357] | ||
Cicerchi C, Li N, Kratzer J et al. Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids. FASEB J. 2014 Apr 22 [PMID: 24755741] (WB, Human, Mouse) | WB | Human, Mouse |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 10/15/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for G6PC Antibody (NBP1-80533)Discover more about diseases related to G6PC Antibody (NBP1-80533).
| Pathways for G6PC Antibody (NBP1-80533)View related products by pathway.
|
PTMs for G6PC Antibody (NBP1-80533)Learn more about PTMs related to G6PC Antibody (NBP1-80533).
|
Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level! The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.