G6PC Antibody

Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml

Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.

Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml

Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

G6PC Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: G6PC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24755741).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for G6PC Antibody

• EC 3.1.3.9
• G6Pase
• G-6-Pase
• G6Pase-alpha
• G6PT
• Glucose-6-phosphatase alpha
• glucose-6-phosphatase
• glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
• glucose-6-phosphatase, catalytic subunit
• GSD1
• GSD1a
• MGC163350

Background

Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for G6PC Antibody (NBP1-80533)(10)

Publications using NBP1-80533

• Nishi K, Yoshii A, Abell L et al. Branched-chain keto acids inhibit mitochondrial pyruvate carrier and suppress gluconeogenesis in hepatocytes Cell reports 2023-06-12 [PMID: 37310861] (WB, Mouse)
• Yu X, Meng Z, Fang T et al. Empagliflozin Inhibits Hepatic Gluconeogenesis and Increases Glycogen Synthesis by AMPK/CREB/GSK3? Signalling Pathway Frontiers in Physiology 2022-03-01 [PMID: 35299662] (WB)
• Bhat N, Narayanan A, Fathzadeh M et al. Dyrk1b promotes hepatic lipogenesis by bypassing canonical insulin signaling and directly activating mTORC2 in mice The Journal of clinical investigation 2021-12-02 [PMID: 34855620] (WB)
• Pang H, Li J, Wang Y et al. Mice lacking the proton channel Hv1 exhibit a sex-specific differences in glucose homeostasis The Journal of biological chemistry 2021-09-18 [PMID: 34547291] (WB, Mouse)
• Ji YX, Wang Y, Li PL et al. A kinome screen reveals that Nemo-like kinase is a key suppressor of hepatic gluconeogenesis Cell metabolism 2021-06-01 [PMID: 33951476]
• Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat Med 2014-11-01 [PMID: 25282357]
• Cicerchi Christina, Li Nanxing, Kratzer James et al. Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids. FASEB J. 2014-04-22 [PMID: 24755741] (WB, Mouse, Human)
• Marquart TJ, Allen RM, Chen MR, Dorn GW Statins Stimulate Hepatic Glucose Production via the miR-183/96/182 Cluster bioRxiv 2019-08-07 (WB, Mouse)
• Chen S, Henderson A, Petriello M et al. Trimethylamine N-Oxide Binds and Activates PERK to Promote Metabolic Dysfunction Cell Metab. 2019-09-17 [PMID: 31543404]
• Nishi K, Abell L, Frausto R et al. Branched-Chain Keto Acid Inhibits Mitochondrial Pyruvate Carrier and Suppresses Gluconeogenesis SSRN Electronic Journal 2022-02-04 (WB, Mouse)

Review for G6PC Antibody (NBP1-80533) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 10/15/2018

Summary

• Application: Western Blot
• Sample Tested: mouse liver
• Species: Mouse
• Lot: NBP1-80533

Bioinformatics

• Gene Symbol: G6PC
• Entrez:
  • 2538(Human)
  • 14377(Mouse)
• Uniprot:
  • P35576(Mouse)