Home » G6PC » G6PC Antibodies » G6PC Antibody

G6PC Antibody

 (8 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

G6PC Antibody Summary

Immunogen
Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G6PC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-80533 in the following application:
Publications
Read Publications using
NBP1-80533 in the following applications:

  • WB
    5 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24755741).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for G6PC Antibody

  • EC 3.1.3.9
  • G6Pase
  • G-6-Pase
  • G6Pase-alpha
  • G6PT
  • Glucose-6-phosphatase alpha
  • glucose-6-phosphatase
  • glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
  • glucose-6-phosphatase, catalytic subunit
  • GSD1
  • GSD1a
  • MGC163350

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glucokinase/GCK
Antibody (OTI3E3)
NBP1-47778
Immunocytochemistry/Immunofluorescence: Glucokinase/GCK Antibody (3E3) [NBP1-47778] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY GCK.
Immunohistochemistry-Paraffin: Glucokinase/GCK Antibody (3E3) [NBP1-47778] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-GCK mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucokinase/GCK Antibody (3E3) [NBP1-47778] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-GCK mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PCK2 Antibody
(JB52-39)
NBP2-75610
Flow Cytometry: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of MCF-7 cells with PCK2 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (JB52-39) [NBP2-75610] - Staining PCK2 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (JB52-39) [NBP2-75610] - Staining PCK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
SLC37A4 Antibody
NBP2-31972
Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP2-31972] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining in human kidney and lymph node tissues using anti-SLC37A4 antibody. Corresponding SLC37A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human lymph node shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: ME1 Antibody [NBP1-32398] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
ME2 Antibody
NBP1-89559
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
ME3 Antibody
NBP1-85871
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human testis shows moderate to strong granular cytoplasmic positivity.
Species: Hu
Applications: IHC, IHC-P, WB
FoxO1/FKHR
Antibody (83N7F8) - B
NBP2-31376
Flow Cytometry: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - Using the Alexa Fluor 488 direct conjugate An intracellular stain was performed on Daudi cells with FoxO1/FKHR (83N7F8) antibody NBP2-31376AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - An intracellular stain was performed on U2-OS cells with FoxO1/FKHR [83N7F8] Antibody NBP2-31376AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - An intracellular stain was performed on RH-30 cells with FoxO1/FKHR Antibody [83N7F8] NBP2-31376AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
G6PC2 Antibody
NBP3-12306
Immunohistochemistry-Paraffin: G6PC2 Antibody [NBP3-12306] - Mouse small intestine. 1:50 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 20X magnfication.
Immunohistochemistry-Paraffin: G6PC2 Antibody [NBP3-12306] - Mouse small intestine. 1:50 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnfication.
Western Blot: G6PC2 Antibody [NBP3-12306] - 1:500 antibody dilution in DiluObuffer.
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
GGT1 Antibody (1F9)
H00002678-M01
Western Blot: GGT1 Antibody (1F9) [H00002678-M01] - GGT1 monoclonal antibody (M01), clone 1F9 Analysis of GGT1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Immunoprecipitation: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.
(7 Publications)
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Glycerol Kinase
Antibody (8S4T8)
NBP3-15687
Immunohistochemistry-Paraffin: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Immunohistochemistry of paraffin-embedded rat kidney using Glycerol Kinase Rabbit mAb (NBP3-15687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Immunohistochemistry of paraffin-embedded mouse testis using Glycerol Kinase Rabbit mAb (NBP3-15687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Glycerol Kinase Antibody (8S4T8) [NBP3-15687] - Western blot analysis of extracts of various cell lines, using Glycerol Kinase (GK) antibody (NBP3-15687) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Pyruvate
Carboxylase Antibody ...
NBP1-49536
Immunocytochemistry/Immunofluorescence: Pyruvate Carboxylase Antibody [NBP1-49536] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- (NBP1-49536) at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: Pyruvate Carboxylase Antibody [NBP1-49536] - Characterization of MPC1-/- in the RM-1 murine prostate cancer cells. Western blotting results of subcellular proteins from WT and MPC1-/- cells and corresponding densitometry histograms of ALT1 and Pyruvate Carboxylase. Cyto means cytoplasmic protein. Mito stands for mitochondrial protein. Protein alpha-Tublin was used as a loading control. ***P<0.001. All experiments were performed at least three times with consistent and repeatable results. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.18199), licensed under a CC-BY licence.
Knockdown Validated: Pyruvate Carboxylase Antibody [NBP1-49536] - HSV-1 replication is inhibited by reducing flux from glucose toward pyrimidine nucleotide synthesis. RNA interference knockdown of pyruvate carboxylase (marked by arrow) in MRC5 cells. Cells were transfected with non-targeting siRNAs (NT) or siRNAs targeting pyruvate carboxylase (PC) and harvested at indicated time points after transfection. Pyruvate carboxylase levels in the cells were detected by western blot using specific antibodies. Beta-actin was employed as a loading control. Divergent effects of human cytomegalovirus and herpes simplex virus-1 on cellular metabolism. PLoS Pathog (2011)
(14 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
G6PC Antibody
NBP1-80533
G6PC Antibody
Species: Hu, Mu
Applications: WB

Publications for G6PC Antibody (NBP1-80533)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(5)
All Applications
Filter By Species
Human
(1)
Mouse
(4)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-80533 Applications Species
Bhat N, Narayanan A, Fathzadeh M et al. Dyrk1b promotes hepatic lipogenesis by bypassing canonical insulin signaling and directly activating mTORC2 in mice The Journal of clinical investigation Dec 2 2021 [PMID: 34855620] (WB) WB
Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat Med 2014 Nov [PMID: 25282357]
Cicerchi C, Li N, Kratzer J et al. Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids. FASEB J. 2014 Apr 22 [PMID: 24755741] (WB, Human, Mouse) WB Human, Mouse
Marquart TJ, Allen RM, Chen MR, Dorn GW Statins Stimulate Hepatic Glucose Production via the miR-183/96/182 Cluster bioRxiv Aug 7 2019 (WB, Mouse) WB Mouse
Pang H, Li J, Wang Y et al. Mice lacking the proton channel Hv1 exhibit a sex-specific differences in glucose homeostasis The Journal of biological chemistry Sep 18 2021 [PMID: 34547291] (WB, Mouse) WB Mouse
Ji YX, Wang Y, Li PL et al. A kinome screen reveals that Nemo-like kinase is a key suppressor of hepatic gluconeogenesis Cell metabolism Jun 1 2021 [PMID: 33951476]
Chen S, Henderson A, Petriello M et al. Trimethylamine N-Oxide Binds and Activates PERK to Promote Metabolic Dysfunction Cell Metab. Sep 17 2019 [PMID: 31543404]
Nishi K, Abell L, Frausto R et al. Branched-Chain Keto Acid Inhibits Mitochondrial Pyruvate Carrier and Suppresses Gluconeogenesis SSRN Electronic Journal Feb 4 2022 (WB, Mouse) WB Mouse

Review for G6PC Antibody (NBP1-80533) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80533:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot G6PC NBP1-80533
Enlarge 		4
reviewed by:
Verified Customer
 WB Mouse 10/15/2018
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver
SpeciesMouse
LotNBP1-80533

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G6PC Antibody (NBP1-80533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G6PC Products

Bioinformatics Tool for G6PC Antibody (NBP1-80533)

Discover related pathways, diseases and genes to G6PC Antibody (NBP1-80533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G6PC Antibody (NBP1-80533)

Discover more about diseases related to G6PC Antibody (NBP1-80533).
 

Pathways for G6PC Antibody (NBP1-80533)

View related products by pathway.

PTMs for G6PC Antibody (NBP1-80533)

Learn more about PTMs related to G6PC Antibody (NBP1-80533).

Blogs on G6PC.

Check out the latest blog posts on G6PC.
Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level!
The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot G6PC NBP1-80533
Enlarge
 Verified Customer
10/15/2018
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol G6PC
Entrez
Uniprot