G6PC Antibody

Images

 
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G6PC Antibody Summary

Immunogen
Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G6PC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-80533 in the following application:

Publications
Read Publications using
NBP1-80533 in the following applications:

  • WB
    5 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24755741).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for G6PC Antibody

  • EC 3.1.3.9
  • G6Pase
  • G-6-Pase
  • G6Pase-alpha
  • G6PT
  • Glucose-6-phosphatase alpha
  • glucose-6-phosphatase
  • glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
  • glucose-6-phosphatase, catalytic subunit
  • GSD1
  • GSD1a
  • MGC163350

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75610
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-31972
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85871
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP3-12306
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80533
Species: Hu, Mu
Applications: WB

Publications for G6PC Antibody (NBP1-80533)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(5)
All Applications
Filter By Species
Human
(1)
Mouse
(4)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-80533 Applications Species
Bhat N, Narayanan A, Fathzadeh M et al. Dyrk1b promotes hepatic lipogenesis by bypassing canonical insulin signaling and directly activating mTORC2 in mice The Journal of clinical investigation Dec 2 2021 [PMID: 34855620] (WB) WB
Tao H, Zhang Y, Zeng X et al. Niclosamide ethanolamine-induced mild mitochondrial uncoupling improves diabetic symptoms in mice. Nat Med 2014 Nov [PMID: 25282357]
Cicerchi C, Li N, Kratzer J et al. Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids. FASEB J. 2014 Apr 22 [PMID: 24755741] (WB, Human, Mouse) WB Human, Mouse
Marquart TJ, Allen RM, Chen MR, Dorn GW Statins Stimulate Hepatic Glucose Production via the miR-183/96/182 Cluster bioRxiv Aug 7 2019 (WB, Mouse) WB Mouse
Pang H, Li J, Wang Y et al. Mice lacking the proton channel Hv1 exhibit a sex-specific differences in glucose homeostasis The Journal of biological chemistry Sep 18 2021 [PMID: 34547291] (WB, Mouse) WB Mouse
Ji YX, Wang Y, Li PL et al. A kinome screen reveals that Nemo-like kinase is a key suppressor of hepatic gluconeogenesis Cell metabolism Jun 1 2021 [PMID: 33951476]
Chen S, Henderson A, Petriello M et al. Trimethylamine N-Oxide Binds and Activates PERK to Promote Metabolic Dysfunction Cell Metab. Sep 17 2019 [PMID: 31543404]
Nishi K, Abell L, Frausto R et al. Branched-Chain Keto Acid Inhibits Mitochondrial Pyruvate Carrier and Suppresses Gluconeogenesis SSRN Electronic Journal Feb 4 2022 (WB, Mouse) WB Mouse

Review for G6PC Antibody (NBP1-80533) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80533:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot G6PC NBP1-80533
Enlarge
4
reviewed by:
Verified Customer
WB Mouse 10/15/2018
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver
SpeciesMouse
LotNBP1-80533

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G6PC Antibody (NBP1-80533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G6PC Products

Bioinformatics Tool for G6PC Antibody (NBP1-80533)

Discover related pathways, diseases and genes to G6PC Antibody (NBP1-80533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G6PC Antibody (NBP1-80533)

Discover more about diseases related to G6PC Antibody (NBP1-80533).
 

Pathways for G6PC Antibody (NBP1-80533)

View related products by pathway.

PTMs for G6PC Antibody (NBP1-80533)

Learn more about PTMs related to G6PC Antibody (NBP1-80533).

Blogs on G6PC.

Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level!
The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
10/15/2018
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol G6PC
Entrez
Uniprot