Home » G6PC » G6PC Antibodies » G6PC Antibody

G6PC Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

G6PC Antibody Summary

Immunogen
Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G6PC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-80533 in the following application:
Publications
Read Publications using
NBP1-80533 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for G6PC Antibody

  • EC 3.1.3.9
  • G6Pase
  • G-6-Pase
  • G6Pase-alpha
  • G6PT
  • Glucose-6-phosphatase alpha
  • glucose-6-phosphatase
  • glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
  • glucose-6-phosphatase, catalytic subunit
  • GSD1
  • GSD1a
  • MGC163350

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Glucokinase/GCK
Antibody
NBP1-33144
Western Blot: Glucokinase/GCK Antibody [NBP1-33144] - A. 30 ug Huh7 whole cell lysate/extract B. 30 ug Hep3B whole cell lysate/extract C. 30 ug HepG2 whole cell lysate/extract 10% SDS-PAGE GCK antibody dilution: 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Glucokinase/GCK Antibody [NBP1-33144] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Glucokinase protein stained by Glucokinase antibody [N1C1-2] diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glucokinase/GCK Antibody [NBP1-33144] - Paraffin-embedded MCF7 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PCK2 Antibody
NBP2-33685
Western Blot: PCK2 Antibody [NBP2-33685] - Analysis using Anti-PCK2 antibody NBP2-33685 (A) shows similar pattern to independent antibody NBP2-33606 (B).
Immunocytochemistry/Immunofluorescence: PCK2 Antibody [NBP2-33685] - Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 or 25 mcg for human; 20 mcg for mouse WB; 1 mg for mouse IP/WB) from human umbilical vein endothelial cells or mouse peritoneal macrophages from wildtype or G6PD deficient mice. Antibody: Affinity purified rabbit anti-G6PD used at 0.6 mcg/ml (A) and 0.5 mcg/ml (B) for WB or 3.75 mcg/mg lysate for IP (B). Detection: Chemiluminescence.
(17 Publications)
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
SLC37A4 Antibody
NBP1-59877
Western Blot: SLC37A4 Antibody [NBP1-59877] - Human Brain lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP1-59877] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, moderate tissue distribution; Primary Antibody Concentration: 1:100
Species: Hu
Applications: WB, ICC/IF, IHC
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: ME1 Antibody [NBP1-32398] - Paraffin-embedded human ovarian carcinoma. ME1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
ME2 Antibody
NBP1-89559
Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human colon.
Western Blot: ME2 Antibody [NBP1-89559] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
ME3 Antibody
NBP1-85871
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Species: Hu
Applications: WB, IHC, IHC-P
FoxO1/FKHR
Antibody (83N7F8)
NBP2-31376
Western Blot: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - Analysis of (A) Ntera2 cell lysate, (B) HEK293 cell lysate, and (C) human placenta tissue using FOXO1A antibody at a concentration of 2 ug/ml.
Immunocytochemistry/Immunofluorescence: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - FOXO1A antibody was tested in Ntera2 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). An antibody concentration of 0.1 ug/ml was used. Image objective 40x.
Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - Analysis of FOXO1A protein in a section of normal human uterus by using FOXO1A antibody at a concentration of 5 ug/ml. The columnar cells of straight non-convoluted glands in uterous showed specific staining for FOXO1A in the cellular cytoplasm as well as nuclei, whereas the stromal cells showed mild cytoplasmic staining only.
(1 Review)
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow

5'-Nucleotidase/CD73 A
NBP1-85740
Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.
Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong membranous positivity in glandular cells.
(4 Reviews)
(6 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC
G6PC2
Overexpression Lysate
NBL1-10897
Western Blot: G6PC2 Overexpression Lysate (Adult Normal) [NBL1-10897] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for G6PC2.
(1 Review)
Species: Hu
GGT1 Antibody (1F9)
H00002678-M01
Western Blot: GGT1 Antibody (1F9) [H00002678-M01] - GGT1 monoclonal antibody (M01), clone 1F9 Analysis of GGT1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Immunoprecipitation: GGT1 Antibody (1F9) [H00002678-M01] - Analysis of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.
(6 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Glycerol Kinase
Antibody
NBP1-57033
Western Blot: Glycerol kinase Antibody [NBP1-57033] - U937 cell lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(39 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Pyruvate
Carboxylase Antibody
NBP1-49536
Western Blot: Pyruvate Carboxylase Antibody [NBP1-49536] - Analysis of Pyruvate Carboxylase in A. Human liver extracts and B. Mouse liver extracts
Immunocytochemistry/Immunofluorescence: Pyruvate Carboxylase Antibody [NBP1-49536] - Immunocytochemistry of Pyruvate Carboxylase in HeLa using NBP1-49536. Nuclei (Blue) are counterstained using Hoechst 33258.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP1-49536] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse kidney using rabbit anti-Pyruvate Carboxylase antibody at 1:200 dilution. The signal was developed using HRP conjugated anti-rabbit secondary antibody and DAB reagent. The nuclei were counterstained using hematoxylin. This Pyruvate Carboxylase antibody generated a diffused cytoplasmic staining in all the tubules and a subset of cells in glomerular cells.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
G6PC Antibody
NBP1-80533
G6PC Antibody
Species: Mu
Applications: WB

Publications for G6PC Antibody (NBP1-80533)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Review for G6PC Antibody (NBP1-80533) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80533:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot G6PC NBP1-80533
Enlarge
reviewed by:
Anonymous
 WB Mouse 10/15/2018
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver
SpeciesMouse
LotNBP1-80533

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G6PC Antibody (NBP1-80533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for G6PC Antibody (NBP1-80533)

Discover related pathways, diseases and genes to G6PC Antibody (NBP1-80533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G6PC Antibody (NBP1-80533)

Discover more about diseases related to G6PC Antibody (NBP1-80533).
 

Pathways for G6PC Antibody (NBP1-80533)

View related products by pathway.

PTMs for G6PC Antibody (NBP1-80533)

Learn more about PTMs related to G6PC Antibody (NBP1-80533).

Blogs on G6PC.

Check out the latest blog posts on G6PC.
Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level!
The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot G6PC NBP1-80533
Enlarge
 Anonymous
10/15/2018
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol G6PC
Entrez
Uniprot