CYP8B1 Antibody

Images

 
Western Blot: CYP8B1 Antibody [NBP1-68884] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP8B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP8B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP8B1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP8B1 Antibody

  • CP8B
  • CYP127 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase
  • CYPVIIIB1
  • Cytochrome P450 8B1
  • cytochrome P450, family 8, subfamily B, polypeptide 1
  • cytochrome P450, subfamily VIIIB (sterol 12-alpha-hydroxylase), polypeptide 1,7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
  • EC 1.14.13.95
  • FLJ17826,7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase
  • Sterol 12-alpha-hydroxylase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the conversion of 7 alpha-hydroxy-4-cholesten-3-one into 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one. The balance between these two steroids determines the relative amounts of cholic acid and chenodeoxycholic acid both of which are secreted in the bile and affect the solubility of cholesterol. This gene is unique among the cytochrome P450 genes in that it is intronless.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9120
Species: Hu
Applications: ICC
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46522
Species: Hu
Applications: WB, IHC
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-68884
Species: Hu
Applications: WB

Publications for CYP8B1 Antibody (NBP1-68884) (0)

There are no publications for CYP8B1 Antibody (NBP1-68884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP8B1 Antibody (NBP1-68884) (0)

There are no reviews for CYP8B1 Antibody (NBP1-68884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP8B1 Antibody (NBP1-68884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP8B1 Products

CYP8B1 NBP1-68884

Bioinformatics Tool for CYP8B1 Antibody (NBP1-68884)

Discover related pathways, diseases and genes to CYP8B1 Antibody (NBP1-68884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP8B1 Antibody (NBP1-68884)

Discover more about diseases related to CYP8B1 Antibody (NBP1-68884).
 

Pathways for CYP8B1 Antibody (NBP1-68884)

View related products by pathway.

PTMs for CYP8B1 Antibody (NBP1-68884)

Learn more about PTMs related to CYP8B1 Antibody (NBP1-68884).

Blogs on CYP8B1

There are no specific blogs for CYP8B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP8B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP8B1
Uniprot