SH3BP2 Antibody

Images

 
Western Blot: SH3BP2 Antibody [NBP1-85458] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SH3BP2 Antibody [NBP1-85458] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SH3BP2 Antibody [NBP1-85458] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3BP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SH3BP2 Protein (NBP1-85458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BP2 Antibody

  • Abl-SH3 binding protein 2
  • Cherubism
  • CRBM
  • CRPM
  • FLJ42079
  • FLJ54978,3BP-2,3BP2
  • RES4-23
  • SH3 domain-binding protein 2
  • SH3-domain binding protein 2
  • TNFAIP3 interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-49154
Species: Hu
Applications: IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA

Publications for SH3BP2 Antibody (NBP1-85458) (0)

There are no publications for SH3BP2 Antibody (NBP1-85458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP2 Antibody (NBP1-85458) (0)

There are no reviews for SH3BP2 Antibody (NBP1-85458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SH3BP2 Antibody (NBP1-85458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3BP2 Products

Bioinformatics Tool for SH3BP2 Antibody (NBP1-85458)

Discover related pathways, diseases and genes to SH3BP2 Antibody (NBP1-85458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP2 Antibody (NBP1-85458)

Discover more about diseases related to SH3BP2 Antibody (NBP1-85458).
 

Pathways for SH3BP2 Antibody (NBP1-85458)

View related products by pathway.

PTMs for SH3BP2 Antibody (NBP1-85458)

Learn more about PTMs related to SH3BP2 Antibody (NBP1-85458).
 

Research Areas for SH3BP2 Antibody (NBP1-85458)

Find related products by research area.

Blogs on SH3BP2

There are no specific blogs for SH3BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP2