MTTP Antibody

Images

 
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTTP Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTTP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MTTP and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTTP Antibody

  • 88kD)
  • 88kDa)
  • ABL
  • MGC149819
  • microsomal triglyceride transfer protein large subunit
  • microsomal triglyceride transfer protein
  • MTPMGC149820

Background

MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB200-527
Species: Hu, Mu
Applications: WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MTTP Antibody (NBP1-62489) (0)

There are no publications for MTTP Antibody (NBP1-62489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTTP Antibody (NBP1-62489) (0)

There are no reviews for MTTP Antibody (NBP1-62489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTTP Antibody (NBP1-62489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTTP Products

Bioinformatics Tool for MTTP Antibody (NBP1-62489)

Discover related pathways, diseases and genes to MTTP Antibody (NBP1-62489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTTP Antibody (NBP1-62489)

Discover more about diseases related to MTTP Antibody (NBP1-62489).
 

Pathways for MTTP Antibody (NBP1-62489)

View related products by pathway.

PTMs for MTTP Antibody (NBP1-62489)

Learn more about PTMs related to MTTP Antibody (NBP1-62489).

Blogs on MTTP

There are no specific blogs for MTTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTTP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTTP
Entrez
Uniprot