MTTP Antibody


Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western more
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.

Product Details

Reactivity Hu, Mu, Dr, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

MTTP Antibody Summary

Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2 - 1 ug/mL
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-62489 in the following application:

Read Publication using NBP1-62489.

Reactivity Notes

Immunostaining on Drosophila third instar larvae has been published. Mouse reactivity reported in scientific literature (PMID: 29844386).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTTP Antibody

  • 88kD)
  • 88kDa)
  • ABL
  • MGC149819
  • microsomal triglyceride transfer protein large subunit
  • microsomal triglyceride transfer protein
  • MTPMGC149820


MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, MiAr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Bv, Rb
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MTTP Antibody (NBP1-62489)(1)

We have publications tested in 1 confirmed species: Mouse.

Filter By Application
All Applications
Filter By Species
All Species

Review for MTTP Antibody (NBP1-62489) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-62489:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot MTTP NBP1-62489
reviewed by:
WB Mouse 10/23/2019


ApplicationWestern Blot
Sample TestedAdult small intestine


CommentsMouse small intestine was homogenised and protein content was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody Mttp diluted 1:1000 in 5% BSA 2, before incubation with anti rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTTP Antibody (NBP1-62489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MTTP Products

Bioinformatics Tool for MTTP Antibody (NBP1-62489)

Discover related pathways, diseases and genes to MTTP Antibody (NBP1-62489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTTP Antibody (NBP1-62489)

Discover more about diseases related to MTTP Antibody (NBP1-62489).

Pathways for MTTP Antibody (NBP1-62489)

View related products by pathway.

PTMs for MTTP Antibody (NBP1-62489)

Learn more about PTMs related to MTTP Antibody (NBP1-62489).

Blogs on MTTP

There are no specific blogs for MTTP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Mouse


Gene Symbol MTTP