Reactivity | Hu, Mu, Dr, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MTTP |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 97 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-62489 | Applications | Species |
---|---|---|
Bricambert J, Alves-Guerra MC, Esteves P et al. The histone demethylase Phf2 acts as a molecular checkpoint to prevent NAFLD progression during obesity Nat Commun May 29 2018 [PMID: 29844386] (Mouse) | Mouse |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 10/23/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for MTTP Antibody (NBP1-62489)Discover more about diseases related to MTTP Antibody (NBP1-62489).
| Pathways for MTTP Antibody (NBP1-62489)View related products by pathway.
|
PTMs for MTTP Antibody (NBP1-62489)Learn more about PTMs related to MTTP Antibody (NBP1-62489).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.