MTTP Antibody

Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.

Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.

• Reactivity: Hu, Mu, Dr
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MTTP Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTTP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Immunostaining on Drosophila third instar larvae has been published. Mouse reactivity reported in scientific literature (PMID: 29844386).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTTP Antibody

• 88kD)
• 88kDa)
• ABL
• MGC149819
• microsomal triglyceride transfer protein large subunit
• microsomal triglyceride transfer protein
• MTPMGC149820

Background

MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTTP Antibody (NBP1-62489)(1)

Publication using NBP1-62489

• Bricambert J, Alves-Guerra MC, Esteves P et al. The histone demethylase Phf2 acts as a molecular checkpoint to prevent NAFLD progression during obesity Nat Commun 2018-05-29 [PMID: 29844386] (Mouse)

Review for MTTP Antibody (NBP1-62489) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Natalie North WB Mouse 10/23/2019

Summary

• Application: Western Blot
• Sample Tested: Adult small intestine
• Species: Mouse
• Lot: QC15947-43641

Comments

• Comments: Mouse small intestine was homogenised and protein content was quantified by a BCA assay. Twenty micrograms of protein were resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membranes. Membranes were probed with primary antibody Mttp diluted 1:1000 in 5% BSA 2, before incubation with anti rabbit secondary horseradish peroxidase-conjugated antibody 1:5000. Blots were visualised with Immobilon Western Chemiluminescence HRP Substrate and imaged with Syngene chemiluminescence imaging system.

Bioinformatics

• Gene Symbol: MTTP
• Entrez:
  • 4547(Human)
• Uniprot:
  • P55157(Human)