SH2D1A Antibody (1C9)

Images

 
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - SH2D1A monoclonal antibody (M01), clone 1C9 Analysis of SH2D1A expression in Jurkat.
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.Lane 1: SH2D1A transfected lysate(14.2 KDa).Lane 2: ...read more
ELISA: SH2D1A Antibody (1C9) [H00004068-M01] - Detection limit for recombinant GST tagged SH2D1A is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SH2D1A Antibody (1C9) Summary

Immunogen
SH2D1A (AAH20732, 1 a.a. - 128 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Specificity
SH2D1A - SH2 domain protein 1A, Duncan's disease (lymphoproliferative syndrome)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SH2D1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00004068-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH2D1A Antibody (1C9)

  • DSHP
  • DSHPLYP
  • Duncan disease SH2-protein
  • EBVS
  • FLJ92177
  • IMD5
  • LYP
  • MTCP1
  • SAP/SH2D1A
  • SAPlymphoproliferative syndrome
  • SH2 domain containing 1A
  • SH2 domain-containing protein 1A
  • SH2D1A
  • signaling lymphocyte activation molecule-associated protein
  • Signaling lymphocytic activation molecule-associated protein
  • SLAM associated protein/SH2 domain protein 1A
  • SLAM-associated protein
  • T cell signal transduction molecule SAP
  • T-cell signal transduction molecule SAP
  • XLP
  • XLPD
  • XLPDFLJ18687
  • XLPSH2 domain protein 1A

Background

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4330
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
7270-IL/CF
Species: Hu
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC

Publications for SH2D1A Antibody (H00004068-M01)(8)


Showing Publications 1 - 8 of 8.
Publications using H00004068-M01 Applications Species
Panchal N, Houghton B, Diez B et al. Transfer of gene corrected T cells corrects humoral and cytotoxic defects in X-linked lymphoproliferative disease (XLP1). J Allergy Clin Immunol Apr 26 2018 [PMID: 29705247]
Cetica V, Sieni E, Pende D et al. Genetic predisposition to hemophagocytic lymphohistiocytosis: Report on 500 patients from the Italian registry. Journal of Allergy and Clinical Immunology Sep 2 2015
Cetica V, Sieni E, Pende D et al. Genetic predisposition to hemophagocytic lymphohistiocytosis: Report on 500 patients from the Italian registry. Journal of Allergy and Clinical Immunology. 2015 Sep [PMID: 26342526]
Meazza R, Tuberosa C, Cetica V et al. Diagnosing XLP1 in patients with hemophagocytic lymphohistiocytosis. J Allergy Clin Immunol. 2014 Jun 27 [PMID: 24985396]
Menard L, Cantaert T, Chamberlain N et al. Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance. J Allergy Clin Immunol. 2013 Dec 24 [PMID: 24373350]
Palendira U, Low C, Bell AI et al. Expansion of somatically reverted memory CD8+ T cells in patients with X-linked lymphoproliferative disease caused by selective pressure from Epstein-Barr virus. J Exp Med. 2012 Apr 09 [PMID: 22493517]
Palendira U, Low C, Chan A et al. Molecular Pathogenesis of EBV Susceptibility in XLP as Revealed by Analysis of Female Carriers with Heterozygous Expression of SAP. PLoS Biol. 2011 Nov 01 [PMID: 22069374]
Ma CS, Suryani S, Avery DT et al. Early commitment of naive human CD4(+) T cells to the T follicular helper (T(FH)) cell lineage is induced by IL-12. Immunol Cell Biol. 2009 Sep 1. [PMID: 19721453]

Reviews for SH2D1A Antibody (H00004068-M01) (0)

There are no reviews for SH2D1A Antibody (H00004068-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH2D1A Antibody (H00004068-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH2D1A Products

Bioinformatics Tool for SH2D1A Antibody (H00004068-M01)

Discover related pathways, diseases and genes to SH2D1A Antibody (H00004068-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH2D1A Antibody (H00004068-M01)

Discover more about diseases related to SH2D1A Antibody (H00004068-M01).
 

Pathways for SH2D1A Antibody (H00004068-M01)

View related products by pathway.

PTMs for SH2D1A Antibody (H00004068-M01)

Learn more about PTMs related to SH2D1A Antibody (H00004068-M01).
 

Research Areas for SH2D1A Antibody (H00004068-M01)

Find related products by research area.

Blogs on SH2D1A

There are no specific blogs for SH2D1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH2D1A Antibody (1C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2D1A
Entrez
OMIM
Uniprot