SPNS1 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit SPNS1 Antibody - BSA Free (NBP1-92440) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPNS1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for SPNS1 Antibody - BSA Free
Background
SPNS1 is a human ortholog of the Drosophila melanogaster spin gene. Many orthologs have been identified in a number of species from nematodes to humans. In drosophila the Spin protein may function in mediating apoptotic signals conveyed from follicle cells to nurse cells or from glia to neurons. The accumulation of lipofuscin-like materials in spin mutant neurons further implies the possible function of the spin gene in regulating lysosomal turnover in nerve cells. SPNS1 may be involved in necrotic or autophagic cell death.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Publications for SPNS1 Antibody (NBP1-92440) (0)
There are no publications for SPNS1 Antibody (NBP1-92440).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPNS1 Antibody (NBP1-92440) (0)
There are no reviews for SPNS1 Antibody (NBP1-92440).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SPNS1 Antibody (NBP1-92440) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPNS1 Products
Research Areas for SPNS1 Antibody (NBP1-92440)
Find related products by research area.
|
Blogs on SPNS1