SPNS1 Antibody


Western Blot: SPNS1 Antibody [NBP1-92440] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry: SPNS1 Antibody [NBP1-92440] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining in human parathyroid gland and pancreas tissues using anti-SPNS1 antibody. Corresponding SPNS1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SPNS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRS
Specificity of human SPNS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPNS1 Protein (NBP1-92440PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SPNS1 Antibody

  • FLJ38358
  • HSpin1Spinster-like protein 1
  • LAT
  • PP2030
  • protein spinster homolog 1
  • SPIN1nrs
  • spinster homolog 1 (Drosophila)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPNS1 Antibody (NBP1-92440) (0)

There are no publications for SPNS1 Antibody (NBP1-92440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPNS1 Antibody (NBP1-92440) (0)

There are no reviews for SPNS1 Antibody (NBP1-92440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPNS1 Antibody (NBP1-92440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SPNS1 Antibody (NBP1-92440)

Discover related pathways, diseases and genes to SPNS1 Antibody (NBP1-92440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPNS1

There are no specific blogs for SPNS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPNS1 Antibody and receive a gift card or discount.


Gene Symbol SPNS1