SPNS1 Antibody

Images

 
Western Blot: SPNS1 Antibody [NBP1-92440] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry: SPNS1 Antibody [NBP1-92440] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining in human parathyroid gland and pancreas tissues using anti-SPNS1 antibody. Corresponding SPNS1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPNS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRS
Specificity
Specificity of human SPNS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPNS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPNS1 Protein (NBP1-92440PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPNS1 Antibody

  • FLJ38358
  • HSpin1Spinster-like protein 1
  • LAT
  • PP2030
  • protein spinster homolog 1
  • SPIN1nrs
  • SPINL
  • spinster homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPNS1 Antibody (NBP1-92440) (0)

There are no publications for SPNS1 Antibody (NBP1-92440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPNS1 Antibody (NBP1-92440) (0)

There are no reviews for SPNS1 Antibody (NBP1-92440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPNS1 Antibody (NBP1-92440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPNS1 Products

Bioinformatics Tool for SPNS1 Antibody (NBP1-92440)

Discover related pathways, diseases and genes to SPNS1 Antibody (NBP1-92440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPNS1

There are no specific blogs for SPNS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPNS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPNS1