SF-1/NR5A1/Steroidogenic Factor 1 Antibody

Images

 
Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF-1/NR5A1/Steroidogenic Factor 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR5A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SF1/Steroidogenic Factor 1 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-52823.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Antibody

  • AD4BP
  • AD4BPSTF-1
  • Adrenal 4-binding protein
  • ELP
  • FTZ1adrenal 4 binding protein
  • FTZF1
  • FTZF1nuclear receptor AdBP4
  • Fushi tarazu factor homolog 1
  • NR5A1
  • Nuclear receptor subfamily 5 group A member 1
  • nuclear receptor subfamily 5, group A, member 1
  • SF1
  • SF-1
  • SF-1POF7
  • SF1steroidogenic factor 1
  • Steroid hormone receptor Ad4BP
  • steroidogenic factor-1

Background

NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7431-00
Species: Hu
Applications: WB
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-56518
Species: Hu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-52823
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823) (0)

There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF-1/NR5A1/Steroidogenic Factor 1 Products

Bioinformatics Tool for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823)

Discover related pathways, diseases and genes to SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823)

Discover more about diseases related to SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823).
 

Pathways for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823)

View related products by pathway.

PTMs for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823)

Learn more about PTMs related to SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823).

Blogs on SF-1/NR5A1/Steroidogenic Factor 1

There are no specific blogs for SF-1/NR5A1/Steroidogenic Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF-1/NR5A1/Steroidogenic Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR5A1
Entrez
Uniprot