Novus Biologicals products are now on bio-techne.com

Serpin F1/PEDF Antibody

Images

 
Western Blot: Serpin F1/PEDF Antibody [NBP1-83972] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Serpin F1/PEDF Antibody [NBP1-83972] - Staining of human hippocampus shows moderate granular positivity in neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin F1/PEDF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serpin F1/PEDF Protein (NBP1-83972PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin F1/PEDF Antibody

  • Cell proliferation-inducing gene 35 protein
  • EPC-1
  • EPC-1PIG35
  • PEDF
  • PEDFpigment epithelium-derived factor
  • pigment epithelium derived factor), member 1
  • proliferation-inducing protein 35
  • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin
  • Serpin F1
  • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 1

Background

The PEDF gene is a member of the serpin gene family. Serpins are a group of serine protease inhibitors, some of which have also been reported to exhibit neurotrophic activity.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
NBP1-56853
Species: Hu
Applications: IHC, IHC-P, WB
DTSP10
Species: Hu
Applications: ELISA
233-FB
Species: Hu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
M6000B
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DCP00
Species: Hu
Applications: ELISA
DNST0
Species: Hu
Applications: ELISA
AF1085
Species: Mu
Applications: IHC, Neut, WB
267-N3
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DMP900
Species: Hu
Applications: ELISA
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA

Publications for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no publications for Serpin F1/PEDF Antibody (NBP1-83972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no reviews for Serpin F1/PEDF Antibody (NBP1-83972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin F1/PEDF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINF1