Serpin F1/PEDF Antibody

Images

 
Western Blot: Serpin F1/PEDF Antibody [NBP1-83972] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Serpin F1/PEDF Antibody [NBP1-83972] - Staining of human hippocampus shows moderate granular positivity in neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin F1/PEDF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serpin F1/PEDF Protein (NBP1-83972PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin F1/PEDF Antibody

  • Cell proliferation-inducing gene 35 protein
  • EPC-1
  • EPC-1PIG35
  • PEDF
  • PEDFpigment epithelium-derived factor
  • pigment epithelium derived factor), member 1
  • proliferation-inducing protein 35
  • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin
  • Serpin F1
  • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no publications for Serpin F1/PEDF Antibody (NBP1-83972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no reviews for Serpin F1/PEDF Antibody (NBP1-83972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin F1/PEDF Antibody (NBP1-83972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin F1/PEDF Products

Bioinformatics Tool for Serpin F1/PEDF Antibody (NBP1-83972)

Discover related pathways, diseases and genes to Serpin F1/PEDF Antibody (NBP1-83972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin F1/PEDF Antibody (NBP1-83972)

Discover more about diseases related to Serpin F1/PEDF Antibody (NBP1-83972).
 

Pathways for Serpin F1/PEDF Antibody (NBP1-83972)

View related products by pathway.

PTMs for Serpin F1/PEDF Antibody (NBP1-83972)

Learn more about PTMs related to Serpin F1/PEDF Antibody (NBP1-83972).

Blogs on Serpin F1/PEDF

There are no specific blogs for Serpin F1/PEDF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin F1/PEDF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINF1
Entrez