SELENBP1 Antibody


Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry: SELENBP1 Antibody [NBP1-54805] - Human Adult heart Observed Staining: Cytoplasmic,Membrane (weak) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary more
Western Blot: SELENBP1 Antibody [NBP1-54805] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.
Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805] - SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x. Image from verfied customer review.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SELENBP1 Antibody Summary

Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the N terminal of SELENBP1. Peptide sequence MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SELENBP1 and was validated on Western blot. Paraffin data from customer review.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-54805 in the following applications:

Read Publication using NBP1-54805.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SELENBP1 Antibody

  • 56 kDa selenium-binding protein
  • hSBP
  • hSP56
  • LPSB
  • SBP
  • SBP56
  • selenium binding protein 1
  • selenium-binding protein 1
  • SP56FLJ13813


SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. This gene product belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. The exact function of this gene is not known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Bv, Hu
Applications: DB, ELISA, WB
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SELENBP1 Antibody (NBP1-54805)(1)

We have publications tested in 1 confirmed species: Mouse.

Filter By Application
All Applications
Filter By Species
All Species

Review for SELENBP1 Antibody (NBP1-54805) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-54805:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SELENBP1 NBP1-54805
reviewed by:
Verified Customer
IHC-P Mouse 05/16/2014


Sample TestedMouse Colon

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SELENBP1 Antibody (NBP1-54805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SELENBP1 Products

Bioinformatics Tool for SELENBP1 Antibody (NBP1-54805)

Discover related pathways, diseases and genes to SELENBP1 Antibody (NBP1-54805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELENBP1 Antibody (NBP1-54805)

Discover more about diseases related to SELENBP1 Antibody (NBP1-54805).

Pathways for SELENBP1 Antibody (NBP1-54805)

View related products by pathway.

PTMs for SELENBP1 Antibody (NBP1-54805)

Learn more about PTMs related to SELENBP1 Antibody (NBP1-54805).

Blogs on SELENBP1

There are no specific blogs for SELENBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: IHC-P
Species: Mouse


Gene Symbol SELENBP1