SELENBP1 Antibody

Images

 
Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry: SELENBP1 Antibody [NBP1-54805] - Human Adult heart Observed Staining: Cytoplasmic,Membrane (weak) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary ...read more
Western Blot: SELENBP1 Antibody [NBP1-54805] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.
Western Blot: SELENBP1 Antibody [NBP1-54805] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry-Paraffin: SELENBP1 Antibody [NBP1-54805] - SELENBP1 in colon mucosa (Mouse), dilution 1:500, 10x, 20x and 40x. Image from verfied customer review.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SELENBP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the N terminal of SELENBP1. Peptide sequence MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Equine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SELENBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SELENBP1 and was validated on Western blot. Paraffin data from customer review.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
SELENBP1 Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 4
using
NBP1-54805 in the following applications:

Publications
Read Publication using NBP1-54805.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SELENBP1 Antibody

  • 56 kDa selenium-binding protein
  • hSBP
  • hSP56
  • LPSB
  • SBP
  • SBP56
  • selenium binding protein 1
  • selenium-binding protein 1
  • SP56FLJ13813

Background

SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. This gene product belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins. The exact function of this gene is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59420
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14228
Species: Hu
Applications: IHC, IHC-P
AF2656
Species: Hu
Applications: WB, IHC
NBP2-94499
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-73624
Species: Hu
Applications: WB, ICC/IF, IHC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00009588-M01
Species: Hu, Bv
Applications: WB, DB, ELISA, S-ELISA
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-54805
Species: Hu, Mu, Rt, Bv, Eq, Gp, Rb
Applications: WB, IHC, IHC-P

Publications for SELENBP1 Antibody (NBP1-54805)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Review for SELENBP1 Antibody (NBP1-54805) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-54805:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SELENBP1 NBP1-54805
Enlarge
reviewed by:
Anonymous
IHC-P Mouse 05/16/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedMouse Colon
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SELENBP1 Antibody (NBP1-54805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SELENBP1 Products

Bioinformatics Tool for SELENBP1 Antibody (NBP1-54805)

Discover related pathways, diseases and genes to SELENBP1 Antibody (NBP1-54805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SELENBP1 Antibody (NBP1-54805)

Discover more about diseases related to SELENBP1 Antibody (NBP1-54805).
 

Pathways for SELENBP1 Antibody (NBP1-54805)

View related products by pathway.

PTMs for SELENBP1 Antibody (NBP1-54805)

Learn more about PTMs related to SELENBP1 Antibody (NBP1-54805).

Blogs on SELENBP1

There are no specific blogs for SELENBP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
05/16/2014
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol SELENBP1
Uniprot